KEGG   Acinetobacter baumannii 1656-2: ABK1_3575Help
Entry
ABK1_3575         CDS       T01819                                 

Definition
(GenBank) aceF
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
abx00010  Glycolysis / Gluconeogenesis
abx00020  Citrate cycle (TCA cycle)
abx00620  Pyruvate metabolism
abx01100  Metabolic pathways
abx01110  Biosynthesis of secondary metabolites
abx01120  Microbial metabolism in diverse environments
abx01130  Biosynthesis of antibiotics
abx01200  Carbon metabolism
Module
abx_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABK1_3575
   00020 Citrate cycle (TCA cycle)
    ABK1_3575
   00620 Pyruvate metabolism
    ABK1_3575
Enzymes [BR:abx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABK1_3575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 RnfC_N ATP-synt_ab_Xtn CAT
Motif
Other DBs
NCBI-ProteinID: ADX05209
Position
complement(3784893..3786872)
Genome map
AA seq 659 aa AA seqDB search
MQIKTPDIGVDKANVAEILVKVGDRVEVDDSIVVLESDKATVEVPSTSAGVVKSILINQG
DDVTEGVALIEIEAEGAAQAAPEPTPAPAAEKPAAPAPAQQTQASAQPAATSTATVEVTV
PDIGVEKALVGEILVKVGDQIDVEQSIVVVESDKATVEVPSSVAGTVESIQVKEGDTVKE
GVVLIQVKTAAASNAQAEAPTTTPAPAAVAEPVAAKQETVAAAPAQSGSVDINVPDLGVD
KAVVAEILVQVGDKVDVDQSLVVVESDKATVEVPSTVAGVVKAIHLQAGQQVSQGVLLAT
IEAEGQAPAAAPAAKAEAAPAPQAAAPKAAAPVATQSAPAASTSGTDKLTKEQEAENAKV
YAGPAVRKLARELGVILSQVKTSGEHGRVVKEDIFAYVKSRLTAPQAAPIAQATAAPAGL
PSLPDFTAFGGGEVKPMTRLQQVSVPQLSLNNYIPQVTQFDLADITELEAWRGELKDGFK
KQGVSLTILAFIAKAVAHLLKEEPYFAGHLADDQKSVLLRNEIHMGIAVATPDGLTVPVL
RNPDQKSIKQIAVELGELSKKARDKKLTPKDLQGANFTITSLGSIGGTAFTPLVNWPQVA
ILGISPATMQPVWNGKDFDPRLMLPLSLSYDHRVINGADAARFTNKLTKLLKDIRTLLI
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaagacccctgatattggtgtagataaagcaaacgtcgctgaaattttagta
aaagttggcgaccgtgttgaagttgacgacagtatcgttgtgcttgagtctgataaagca
actgttgaagtgcctagcacttcagcaggtgtcgtaaaaagtatcttgattaatcaaggt
gatgatgtgactgaaggtgttgctttgattgagatcgaagcagaaggtgcggcacaagca
gcaccggaaccaacaccagctcctgcggctgaaaagccagctgctccagcaccggcgcaa
caaactcaggcttcagctcaacctgctgctacatcaactgcaactgttgaagtgactgta
cctgacatcggtgttgaaaaagcattggttggtgaaatcctcgttaaagtgggtgaccag
atcgatgtcgaacaaagtattgtggttgtagagtcggataaagcgactgtagaagttcca
agtagtgttgctggtactgtagaaagtattcaagtgaaagaaggcgataccgttaaagaa
ggtgttgttcttattcaagtgaaaacagcagctgcatctaatgcgcaagcagaagctcct
actactacaccagctccagctgcggtagcagaaccggttgctgcaaagcaagaaactgtg
gcagcggctccagctcagtctggttcagttgatatcaatgttcctgacttgggtgtagac
aaagctgttgttgctgaaatcttggttcaagttggcgataaagttgatgtagaccaaagc
cttgttgttgtagagtcagataaagcaactgtggaagttccaagtaccgttgctggtgtt
gtaaaagcaattcacttgcaagcaggccaacaagtttcacaaggtgtattgcttgcaaca
attgaagctgaaggccaagcacctgctgctgcaccagcggcaaaagcagaagcagcccca
gctccacaggcagcagcacctaaagcagccgctcctgttgcaactcagtctgcacctgcg
gcgtctacatctggtactgataagttaacgaaagagcaagaagcagaaaacgctaaagtg
tatgctggtcctgctgttcgtaagctggctcgtgaacttggtgtaatcttgtcacaagtt
aaaacttctggtgagcatggccgtgttgtcaaagaagatatctttgcttatgtgaagagt
cgtttaactgcaccgcaagctgcaccaatagctcaagctaccgctgctccggctggattg
ccgtcattacctgactttactgcttttggtggcggtgaagtgaaaccaatgacgcgttta
cagcaagtttctgtaccgcagttgtctttaaacaactacattccacaagtaactcagttt
gaccttgcggatattactgagctagaagcttggcgtggtgagttgaaagacggctttaag
aaacaaggtgtgagcctaacaattttagcatttattgcaaaagcagtagctcacttgttg
aaagaagagccttatttcgcgggtcacttagcagatgatcagaaatctgtattgctccgt
aatgaaatccatatgggtattgcggttgcgactccagatggtttgacagtacctgtacta
cgtaatcctgaccaaaaatcaattaagcaaattgctgttgaattaggtgagttgagtaaa
aaagcgcgtgataagaaattaacaccgaaagatttacaaggtgctaacttcacgatcaca
agcttgggctcaattggcggtacagcatttacgccactagttaactggccacaagttgca
attttgggtatttcacctgcaacgatgcagcctgtatggaatggtaaagactttgatcca
cgcttaatgttgccgttgtcattgtcttatgaccaccgtgtaattaatggtgcggatgca
gcgcgctttacaaataaacttacgaaacttcttaaagatattcgtactttattaatctaa

DBGET integrated database retrieval system