KEGG   Acinetobacter baumannii 1656-2: ABK1_3671Help
Entry
ABK1_3671         CDS       T01819                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
abx  Acinetobacter baumannii 1656-2
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ABK1_3671
Enzymes [BR:abx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ABK1_3671
    3.5.1.-  
     ABK1_3671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3891403..3892047)
Genome map
AA seq 214 aa AA seqDB search
MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNH
ISFAANHPGKQPFETIELDYGLQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHI
DSYSAFMEADHSTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVVEDA
CKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaataaacaaccacaaaattcggctttagtcgtagttgatgtgcaaaatggt
tttacccctggtggaaacctagcagttgccgacgccgatacgattattccaaccattaac
caattggcaggttgttttgaaaatgtagtcctcactcaagactggcatccggataatcat
atttcttttgcagccaaccatccgggcaagcagccatttgaaacgattgaactggattat
ggattacaggtgctttggcctaagcattgtatacaaggcacacatgatgccgaatttcat
ccggatttaaatatcccgacagctcaactgattatccgaaaaggttttcatgctcatatt
gatagttactcggcttttatggaagctgaccactcaacaatgacaggtttaacgggatat
ttaaaagaacgtggtattgatacggtctatgtggtcggaattgccacagacttttgtgtc
gcatggactgctttagatgcggttaagcaaggctttaaaactttagtggttgaagatgcg
tgcaaaggtattgatcttaatggttcattagaacaagcgtggcaaactatgcagcaacaa
ggtgttgttcgtattcaatcgactgatctgttgaatgaatgctag

DBGET integrated database retrieval system