KEGG   Acinetobacter baumannii 1656-2: ABK1_3754Help
Entry
ABK1_3754         CDS       T01819                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abx  Acinetobacter baumannii 1656-2
Brite
Enzymes [BR:abx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABK1_3754
Secretion system [BR:abx02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABK1_3754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
ABKp1:26475..27197
Genome map
AA seq 240 aa AA seqDB search
MKKFLLTFAVAISSYSIAYADVAEDIKSNIQKNYPATTVTQVNKTPLTGIYEVVMGRNVA
YTDKDGRYFIFGNLFDMKTQTDLTTTPTSSNKVEVGFPNADRLKDAIKTVKGNGKRKLVV
FSDPDCPYCQQLERNLQSIDNVTIYTFLYPLESIHPTAKTTAVSIWCSKNPGKAFQDYMI
ENIKPSSKNCAHPIDRNIEFASSMNIQGTPSLIFEDGSMVPGAVGVSELERLLNSSQKSK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttttattaacttttgccgtagcaattagttcctattcaatagcatatgca
gatgtagcagaagatattaagtctaatatccaaaaaaactatccggcaactactgttact
caagtgaataaaactcctttaaccggcatatatgaagtcgtaatgggtagaaatgtggca
tataccgataaagatggtagatacttcatttttggaaatttgtttgatatgaaaacacaa
acagatttaacaacgactccaacaagttcaaacaaagttgaagttggtttcccgaatgct
gatcgtttaaaagatgcaattaaaacagttaaaggcaatgggaaaagaaagctcgtagta
tttagcgatcctgattgcccatattgccaacaattagaacgtaatttgcaatcgattgat
aatgtaacgatttatacattcctttatccgttagagagtattcacccaactgctaaaaca
acagcagtatcaatttggtgttctaagaatcctggtaaagcatttcaagattacatgatt
gaaaatattaagccttcatccaaaaattgcgctcacccaatagatcgtaatattgaattt
gcatcaagtatgaatattcaaggtacaccttcattaatatttgaagacggttcaatggtg
cctggagcagtgggtgtttctgaactagaacgacttctcaattcatctcagaaatcaaaa
taa

DBGET integrated database retrieval system