KEGG   Acinetobacter baumannii AYE: ABAYE0059Help
Entry
ABAYE0059         CDS       T00667                                 

Gene name
pncA
Definition
bifunctional pyrazinamidase/nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:aby00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
66302..66946
Genome map
AA seq 214 aa AA seqDB search
MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNH
ISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHI
DSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDA
CKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaataaacaaccacaaaattcggctttagtcgtagttgacgtgcaaaatggt
tttacccctggtggaaacctagcagttgccgacgccgatacgattattccaaccattaac
caattggcaggttgttttgaaaatgtagtcctcactcaagactggcatccggataatcac
atttcttttgcagccaaccatccgggcaagcagccatttgaaacgattgaactggattat
ggatcacaggtgctttggcctaagcattgtatacaaggcactcatgatgccgaatttcat
ccggatttaaatatcccgacagctcaactgattatccgaaaaggttttcatgctcatatt
gatagttactcggcttttatggaagccgaccacaccacaatgacaggtttaacgggttac
ttaaaagaacgtggtattgatacggtctatgtggtcggaattgccaccgacttttgtgtc
gcatggactgctttagatgcggttaagcaaggctttaaaactttagtgattgaagatgcg
tgcaagggtattgatcttaatggttcattagaacaagcgtggcaaactatgcagcaacaa
ggtgttgttcgtattcaatcgactgatctgttgaatgaatgctag

DBGET integrated database retrieval system