KEGG   Acinetobacter baumannii AYE: ABAYE0158Help
Entry
ABAYE0158         CDS       T00667                                 

Gene name
aceF
Definition
dihydrolipoamide S-acetyltransferase, E2 component of the pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABAYE0158 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABAYE0158 (aceF)
   00020 Citrate cycle (TCA cycle)
    ABAYE0158 (aceF)
   00620 Pyruvate metabolism
    ABAYE0158 (aceF)
Enzymes [BR:aby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABAYE0158 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
173018..174997
Genome map
AA seq 659 aa AA seqDB search
MQIKTPDIGVDKANVAEILVKVGDRVEVDDSIVVLESDKATVEVPSTSAGVVKSILINQG
DDVTEGVALIEIEAEGAAQAAPEPTPAPAAEKPAAPAPAQQTQASAQPAATSSATVEVTV
PDIGVEKALVGEILVKVGDQIDVEQSIVVVESDKATVEVPSSVAGTVESIQVKEGDTVKE
GVVLIQVKTAAASNAQAEAPATTPAPAAVAEPVAAKQETVAAAPAQSGSVDINVPDLGVD
KAIVAEILVQVGDKVDVDQSLVVVESDKATVEVPSTVAGVVKAIHLQAGQQVSQGVLLAT
IEAEGQAPAAAPAAKAEAAPAPQAAAPKAAAPVATQSAPAAPASGTDKLTKEQEAENAKV
YAGPAVRKLARELGVILSQVKTSGEHGRVVKEDIFAYVKSRLTAPQAAPVAQATAAPAGL
PSLPDFTAFGGGEVKPMTRLQQVSVPQLSLNNYIPQVTQFDLADITELEAWRGELKDGFK
KQGVSLTILAFIAKAVAHLLKEEPYFAGHLADDQKSVLLRNEIHMGIAVATPDGLTVPVL
RNPDQKSIKQIAVELGELSKKARDKKLTPKDLQGANFTITSLGSIGGTAFTPLVNWPQVA
ILGISPATMQPVWNGKDFDPRLMLPLSLSYDHRVINGADAARFTNKLTKLLKDIRTLLI
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaagacccctgatattggtgtagataaagcaaacgtcgctgaaattttagta
aaagttggcgaccgtgttgaagttgacgacagtatcgttgtgcttgagtctgataaagca
actgttgaagtgcctagcacttcagcaggtgtcgtaaaaagtatcttgattaatcaaggt
gatgatgtgactgaaggtgttgctttgattgagatcgaagcagaaggtgcggcacaagca
gcaccggaaccaacaccagctcctgcggctgaaaagccagctgctccagcacctgcgcaa
caaactcaagcttcagctcaacctgctgctacatcaagtgcaactgttgaagtgactgta
cctgacatcggtgttgaaaaagcattggttggtgaaatcctcgttaaagtgggtgaccag
atcgatgttgaacaaagtattgtggttgtagagtcagataaagcgactgtagaagttcca
agtagtgttgctggtactgtagaaagtattcaagtgaaagaaggcgatactgttaaagaa
ggtgttgttcttattcaagtgaaaacagcagctgcatctaatgcgcaagcagaagctcct
gctactacaccagctccagctgcggtagcagaaccggttgctgcaaagcaagaaactgtg
gcagcggctccagctcagtctggttcagttgatatcaatgttcctgatttgggtgtagac
aaagctattgttgctgaaatcttggttcaagttggcgataaagttgatgtagaccaaagc
cttgttgttgttgagtcagataaagcaactgtggaagtcccaagtaccgttgctggtgtt
gtaaaagcaattcacttgcaagcaggccaacaagtttcacaaggtgtattgcttgcaaca
attgaagctgaaggccaagcacctgctgctgcaccagcggcaaaagcagaagcagcccca
gctccacaggcagcagcacctaaagcagccgctcctgttgcaactcagtctgcacctgcg
gcacctgcatctggtactgataagttaacgaaagagcaagaagcagaaaacgctaaagtg
tatgctggtcctgctgttcgtaagctggctcgtgaacttggtgtgatcttgtcacaagtt
aaaacttctggtgagcatggccgtgttgttaaagaagatatctttgcttatgtgaagagc
cgtttaactgcaccgcaagctgcaccagtagctcaagctactgctgctccggctggattg
ccgtcattacctgactttactgcttttggtggcggtgaagtaaaaccaatgacgcgttta
cagcaagtttctgtaccgcagttgtctttaaacaactatattccacaagtaactcagttt
gaccttgcggatattactgagctagaagcttggcgtggtgagctgaaagacggctttaag
aaacaaggtgtgagcctaacaattttggcatttattgcaaaagcagtagcacacttgttg
aaagaagagccttattttgcgggtcacttagcagatgatcagaaatctgtattgctccgt
aatgaaatccatatgggtattgcggttgcaactccagatggtttgaccgtgcctgtacta
cgtaatcctgaccaaaaatcaattaagcaaattgctgttgaattaggtgagttgagtaaa
aaagcgcgtgataagaaattaacgccgaaagatttacaaggtgctaacttcacgatcaca
agcttaggctcaattggcggtacagcatttacgccactagttaactggccacaagttgca
attttgggtatttcacctgcaacgatgcagcctgtatggaatggtaaagactttgatcca
cgcttaatgttgccgttgtcattgtcttatgaccaccgtgtaattaatggtgcggatgca
gcgcgctttacaaataaacttacgaaacttcttaaagatattcgtactttattaatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system