KEGG   Acinetobacter baumannii AYE: ABAYE0179Help
Entry
ABAYE0179         CDS       T00667                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00010  Glycolysis / Gluconeogenesis
aby00620  Pyruvate metabolism
aby00640  Propanoate metabolism
aby00680  Methane metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABAYE0179 (acs)
   00620 Pyruvate metabolism
    ABAYE0179 (acs)
   00640 Propanoate metabolism
    ABAYE0179 (acs)
  Energy metabolism
   00680 Methane metabolism
    ABAYE0179 (acs)
Enzymes [BR:aby01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABAYE0179 (acs)
Lipid biosynthesis proteins [BR:aby01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABAYE0179 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CAM85162
UniProt: B0V9B6
Position
193394..195343
Genome map
AA seq 649 aa AA seqDB search
MNEIYPVPEEFKKTARTVEADYFKRYQHSIENPDEFWAEQAKIVDWIKPFTQVKNTSFDK
DNFKIEWFADGELNVSANCLDRHLKEHPHKPAIIWEGDHPSRHKIVSYKELHDEVCRFAN
VLKKYGIGKGDRVVLYMPMVTEAAIAMLACARIGAVHCVVFGGFSPDSLASRIEDSQAKL
VITADSSLRAGKLLPLKENVDLALALPGTECVENVIVVYRNANPIEMKPGRDLWYHLIIM
EVDANCPPEPMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYVASTFKEVFDLKQDDVYW
CTADVGWITGHSYLIYGPLANGTTTLMFEGVPQYPTWARLGHVVDKHKVSILYTAPTAIR
AMMREGDSYVRESNRSSLRLLGSVGEPINPEAWNWYYNVVGEGRCPIVDTWWQTETGGIL
IAPLPGATALKPGSATRPLFGIQPAIVDGEGNELEGAAEGNLVIKDSWPGQMRTIWGDPD
RFIEAYFSTFKNTYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHESV
AEAAVVGMPHDIKGQGICTFVTLQAGVPESEELRKELISWVRKVLGPVASPDALHWAPAL
PKTRSGKIMRRILRKIAANELDSLGDTSTLAEPAVVDQLIATVYPDRQK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagatctatccagtaccagaggaatttaaaaaaacagctcgtactgttgaagca
gactactttaaacgttatcaacactctatcgagaacccagatgaattctgggcagagcaa
gctaaaattgtcgattggataaagccatttacccaagttaaaaataccagttttgacaaa
gacaatttcaagattgaatggtttgctgatggtgagttgaacgtatcagcaaactgcttg
gacaggcatcttaaagaacaccctcacaaacctgcaattatttgggaaggtgaccatcct
tctcgtcataaaatcgtttcttataaagaattacacgacgaagtctgccgtttcgccaac
gttttaaagaaatatggcattggtaaaggtgaccgcgttgtgctgtatatgccaatggtg
actgaggctgcaattgccatgttagcctgtgcccgtattggtgcggtgcactgcgtggta
tttggtggtttctcaccagactcgttggcgagtcgtattgaagatagccaagctaaactt
gtgattacggctgactcaagcctacgtgccggtaagttgttaccacttaaagaaaatgtt
gatttggctctagcattgccgggcacagagtgcgttgaaaacgtgattgtggtttaccgt
aatgcaaacccaatcgagatgaagccgggtcgtgatttgtggtatcaccttattattatg
gaggtggatgcaaactgtcctccagaaccaatgaaggccgaagaccctttatttattctt
tatacctctggctcgacaggtaaacctaaaggagtgttgcatactacaggtggttatctg
gtgtatgtggcgagtacctttaaagaagtttttgatttaaaacaagatgatgtgtactgg
tgtaccgctgatgtcggctggattacaggccatagttatctaatctatggaccattggca
aatggtacgacgaccttaatgtttgaaggtgtgcctcagtatccaacatgggcacgtctt
ggtcatgtggtcgataaacataaagtctctattttatatacagcgccaaccgcgattcga
gccatgatgcgagaaggtgattcgtatgtacgtgaaagtaaccgtagtagtttgcgtttg
ttaggttcagtgggtgaacctattaaccctgaggcttggaactggtactacaatgttgtc
ggcgaaggccgctgcccgattgttgatacatggtggcaaaccgaaacaggtggtattttg
attgcgccattaccgggggcaacagctttaaaaccaggttcggcaacgcgacctttattt
ggtattcaaccagctattgtagatggtgaaggcaatgaactagaaggcgctgccgaaggt
aatcttgtgattaaagattcatggccgggccagatgcgtaccatttggggtgacccagat
cgctttattgaagcttacttctcgacctttaaaaatacttattttacaggtgatggcgcc
cgccgtgatgaagatggctattactggatcacgggtcgtgttgacgatgtcttaaacgtt
tcaggccaccgtctaggtacggctgaaattgaaagtgctcttgtatcgcatgaatcggtg
gcagaggctgctgttgtaggtatgccgcatgatattaaagggcagggtatttgtactttt
gtgactttgcaggcgggtgttccggagtcggaagaactgcgaaaagagttaattagctgg
gtacgtaaagtacttggaccagtggcttcaccagatgcactgcactgggcgccggcatta
cctaaaacccgttcgggtaaaatcatgcgccgtattttaagaaaaattgcagcgaatgaa
ctggatagtttgggcgatacctcaaccctagctgaaccggcagtggtggatcaactgatt
gcgacagtttatcctgatagacaaaaataa

DBGET integrated database retrieval system