KEGG   Acinetobacter baumannii AYE: ABAYE0465Help
Entry
ABAYE0465         CDS       T00667                                 

Gene name
mdh
Definition
malate dehydrogenase (EC:1.1.1.37)
Orthology
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABAYE0465 (mdh)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABAYE0465 (mdh)
   00620 Pyruvate metabolism
    ABAYE0465 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    ABAYE0465 (mdh)
  Energy metabolism
   00680 Methane metabolism
    ABAYE0465 (mdh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ABAYE0465 (mdh)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     ABAYE0465 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481392..482378
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEVPVEKAQQALKGVMMELD
DCAFPLLAGMIGTDDPKVAFKDADYALLVGSRPRGPGMERADLLKVNGEIFIGQGQALNE
VASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHNRALTQVAQKAGVAVADI
EKLTVWGNHSPTMYADYRFATANGESLKDKINDPAWNKDVFLPTVGKRGAAIIEARGLSS
AASAANAAIDHMRDWALGTNGKWVTMGVPSDGSYGIPEGVMFGFPVTTENGEYKIVQGLE
IDEFSRERINFTLNELEEERAAIADMVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacccgttcgtgttgccgtgactggcgctgcaggtcaaattggttacagctta
ttattccgtatcgcaagcggtgaaatgctaggtaaagatcaacctgttattttacaattg
cttgaagttccagttgaaaaagcacaacaagcgcttaaaggcgtaatgatggaacttgat
gactgtgctttccctttattggctggcatgatcgggactgatgatcctaaagttgcattt
aaagatgctgactatgcgttattggtaggttctcgtccacgtggtcctggtatggaacgt
gctgacttgttaaaagttaacggcgaaatcttcattggccaaggtcaagcattaaacgaa
gttgctagccgtgacgttaaagtattagttgtaggtaatcctgcaaacacgaatgcttac
attgcgatgaaatctgctccagatcttccagcgaaaaacttcacagcaatgttgcgtctt
gaccacaaccgtgcgttgactcaagttgctcaaaaagctggtgttgctgtagctgacatc
gaaaaattaacagtttggggtaaccactctccaactatgtatgctgactaccgttttgca
actgctaatggtgaaagcttaaaagacaagatcaacgatccagcttggaacaaagacgta
ttccttccaactgttggtaaacgtggtgctgcgattatcgaagcgcgtggtttgtcttct
gctgcttctgctgctaacgctgcaatcgaccatatgcgtgattgggcacttggtacaaac
ggcaaatgggtaactatgggcgttccttctgacggttcttatggtattcctgaaggcgtt
atgttcggtttccctgtaacaactgaaaacggtgaatacaaaatcgttcaaggtttagaa
atcgatgaattcagccgtgagcgtatcaacttcactctaaacgagcttgaagaagaacgt
gcagcaattgctgacatggtaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system