KEGG   Acinetobacter baumannii AYE: ABAYE0465Help
Entry
ABAYE0465         CDS       T00667                                 

Gene name
mdh
Definition
malate dehydrogenase (EC:1.1.1.37)
Orthology
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Class
Metabolism; Overview; Carbon metabolism [PATH:aby01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aby00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aby00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:aby00630]
Metabolism; Energy metabolism; Methane metabolism [PATH:aby00680]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:aby00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481392..482378
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEVPVEKAQQALKGVMMELD
DCAFPLLAGMIGTDDPKVAFKDADYALLVGSRPRGPGMERADLLKVNGEIFIGQGQALNE
VASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHNRALTQVAQKAGVAVADI
EKLTVWGNHSPTMYADYRFATANGESLKDKINDPAWNKDVFLPTVGKRGAAIIEARGLSS
AASAANAAIDHMRDWALGTNGKWVTMGVPSDGSYGIPEGVMFGFPVTTENGEYKIVQGLE
IDEFSRERINFTLNELEEERAAIADMVK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacccgttcgtgttgccgtgactggcgctgcaggtcaaattggttacagctta
ttattccgtatcgcaagcggtgaaatgctaggtaaagatcaacctgttattttacaattg
cttgaagttccagttgaaaaagcacaacaagcgcttaaaggcgtaatgatggaacttgat
gactgtgctttccctttattggctggcatgatcgggactgatgatcctaaagttgcattt
aaagatgctgactatgcgttattggtaggttctcgtccacgtggtcctggtatggaacgt
gctgacttgttaaaagttaacggcgaaatcttcattggccaaggtcaagcattaaacgaa
gttgctagccgtgacgttaaagtattagttgtaggtaatcctgcaaacacgaatgcttac
attgcgatgaaatctgctccagatcttccagcgaaaaacttcacagcaatgttgcgtctt
gaccacaaccgtgcgttgactcaagttgctcaaaaagctggtgttgctgtagctgacatc
gaaaaattaacagtttggggtaaccactctccaactatgtatgctgactaccgttttgca
actgctaatggtgaaagcttaaaagacaagatcaacgatccagcttggaacaaagacgta
ttccttccaactgttggtaaacgtggtgctgcgattatcgaagcgcgtggtttgtcttct
gctgcttctgctgctaacgctgcaatcgaccatatgcgtgattgggcacttggtacaaac
ggcaaatgggtaactatgggcgttccttctgacggttcttatggtattcctgaaggcgtt
atgttcggtttccctgtaacaactgaaaacggtgaatacaaaatcgttcaaggtttagaa
atcgatgaattcagccgtgagcgtatcaacttcactctaaacgagcttgaagaagaacgt
gcagcaattgctgacatggtaaaataa

DBGET integrated database retrieval system