KEGG   Acinetobacter baumannii AYE: ABAYE0602Help
Entry
ABAYE0602         CDS       T00667                                 

Definition
(GenBank) putative fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby01040  Biosynthesis of unsaturated fatty acids
aby01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABAYE0602
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ABAYE0602
Lipid biosynthesis proteins [BR:aby01004]
 Desaturase
  First
   ABAYE0602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase LXG
Motif
Other DBs
NCBI-ProteinID: CAM85569
UniProt: B0V540
Position
complement(611850..613088)
Genome map
AA seq 412 aa AA seqDB search
MVLLCRFVFLPCITRFLGALPDMTSAPLKAPINWTASITLIGLPILAAIIIPIYAYYYDF
SVSAWVSLFFLLALSSMGITAGYHRLWAHRAYEASLPLKILLMIGGTFAVQNSILFWASG
HRTHHRHVDDVDEDPYSIERGFWYAHMGWMIRDHSPSEPDFKNAPDLLNDKLVMFQHKYY
ALMVVAVHVGILGLVGWATGDLWGVVLLGGLLRLIISHQVTFFINSLCHMFGKRPYTDEN
SARDNFWLAIATWGEGYHNYHHIFQYDYRNGVKWWQYDPTKWLIWTCSKIGLAKNLRRIP
SFNIKKAELAMKFKYAEQDLAIYGHDVNADISQMKQRIAQEYEAFTHTLNDWAKLKEQEL
QAKKAAMAEKIHKMDHKLKVDFQLLEHRLSHHRECLETLMRNIKKNTNVVPD
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
ttggttttgctatgtcgatttgtctttttaccttgtataacaaggtttctaggagcgctg
ccggatatgacttccgccccactcaaggccccaattaactggaccgctagcattacctta
attggtttaccaattcttgctgcaatcataatcccgatttatgcgtattattatgatttt
agtgtaagcgcatgggtaagcttattttttcttttagctttaagtagcatggggattact
gctggttaccatcgtctttgggcacaccgtgcttatgaagcgtcgttaccacttaaaatt
cttttaatgattggcggcacatttgctgtacaaaacagtattctgttttgggcatctggt
caccgtacccatcaccgtcatgtcgacgatgtagatgaagatccatattcaattgaacgt
ggcttttggtatgcccatatgggttggatgatccgcgatcattctccatctgaaccagat
tttaaaaatgcaccagacttactcaatgacaaactggtgatgttccaacataaatactat
gccttgatggtcgtagcagttcacgttggtattttaggtttggttggctgggcaactggc
gatttatggggtgttgtacttcttggtggcctattacgtttaatcattagtcatcaagtt
acattcttcatcaactcactttgccacatgttcggtaaacgcccttataccgatgaaaac
tcagcacgcgataacttctggttagcgattgcaacttggggtgagggttaccacaactat
caccatattttccagtacgactatcgtaatggtgtgaaatggtggcaatatgatccaaca
aaatggctaatctggacatgctctaagattggtttagcaaagaacctacgtcgtattcca
agctttaatattaaaaaagcagaattggcaatgaagtttaaatatgctgaacaagacttg
gctatttatggtcatgatgtaaatgccgacattagtcaaatgaagcaacgtattgctcaa
gagtatgaagcatttacacatactttaaatgactgggcgaaactcaaagaacaagagtta
caagcaaagaaagcagcaatggctgaaaagattcacaaaatggatcacaagttaaaagtt
gatttccaattgcttgaacatcgtttgagtcatcaccgtgagtgtttagaaactttaatg
cgtaacattaaaaagaacacaaacgtcgtaccagactaa

DBGET integrated database retrieval system