KEGG   Acinetobacter baumannii AYE: ABAYE0608Help
Entry
ABAYE0608         CDS       T00667                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABAYE0608 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABAYE0608 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABAYE0608 (trpB)
Enzymes [BR:aby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABAYE0608 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
618143..619354
Genome map
AA seq 403 aa AA seqDB search
MIDYTQFPDANGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQFLAEFDRDLAYYVGR
PSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIAETGAGQ
HGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVVPVQSGSKTLKDAMNEAM
RDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQILEQAGRLPDALVACVGGG
SNAMGLFYPFLNDANVKMYGVEAAGFGIETGKHSAPLNAGHVGVLHGNRTYLMSDEQGQI
IETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTEALQGFRDLTKIEGIIPALESSHA
MAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVEMVEM
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattgactatacccaattcccagatgcaaatgggcatttcggtatccatggcggacgt
tttgtgtcagaaactttaatggcggcattagaagatttggaaaatctctattcccgcatg
aaaaatgatgaacagtttttggcagaattcgaccgtgacctcgcctactatgtaggtcgt
cctagtccactttattatgctgagcgatggtcaaaagagttaggtggtgcgcaaatttac
cttaaacgtgaagacttgaaccatactggctcacacaaggtaaacaacacgattggtcag
gcgttattggcaaagctttctggtaaaaaacgtattattgccgaaactggtgcagggcag
catggtgtagcgacagcaacaattgcagcacgtttaggtcttgaatgtgttgtttatatg
ggtgctgaagacgttaagcgtcaagcgatgaacgtttaccgtatgcgtttgttaggcgct
acagttgttcctgtacaaagtggctctaaaacgttgaaagacgccatgaacgaagcgatg
cgtgactgggtaactaatgttgatacgacgtactatgtgattggtacggttgcaggcccg
catccatatcctcaattggttcgtgacttccagtcgattattggtcgtgaagcgcgtaaa
cagattttggaacaagcaggtcgtttaccagatgcattagttgcctgtgtaggtggcggt
tcaaatgcaatgggcttgttctatccgtttttaaacgatgccaatgtgaaaatgtatggt
gttgaagccgctggttttggtattgaaactggtaaacactctgcgccgttaaatgcgggt
catgtgggtgtattgcacggtaaccgtacttacttgatgagtgatgaacaaggccagatt
attgagacacatagtatctcagcaggtcttgactatccgggtgttggccctgaacatagc
ttcttgaaagatatgaagcgtgtagagtacgtgccgattaatgatacagaagctctacaa
ggtttccgcgacttaactaaaatcgaagggattattcctgcacttgaaagctcgcatgcg
atggcctatgtctctaagcttgcaccgacgatgtctaaagatcagattattattgcgact
gtttcaggtcgtggtgataaagatttaatgacagttgcacgtattgatggcgtagaaatg
gtcgagatgtaa

DBGET integrated database retrieval system