KEGG   Acinetobacter baumannii AYE: ABAYE0608Help
Entry
ABAYE0608         CDS       T00667                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABAYE0608 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABAYE0608 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABAYE0608 (trpB)
Enzymes [BR:aby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABAYE0608 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
618143..619354
Genome map
AA seq 403 aa AA seqDB search
MIDYTQFPDANGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQFLAEFDRDLAYYVGR
PSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIAETGAGQ
HGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVVPVQSGSKTLKDAMNEAM
RDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQILEQAGRLPDALVACVGGG
SNAMGLFYPFLNDANVKMYGVEAAGFGIETGKHSAPLNAGHVGVLHGNRTYLMSDEQGQI
IETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTEALQGFRDLTKIEGIIPALESSHA
MAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVEMVEM
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattgactatacccaattcccagatgcaaatgggcatttcggtatccatggcggacgt
tttgtgtcagaaactttaatggcggcattagaagatttggaaaatctctattcccgcatg
aaaaatgatgaacagtttttggcagaattcgaccgtgacctcgcctactatgtaggtcgt
cctagtccactttattatgctgagcgatggtcaaaagagttaggtggtgcgcaaatttac
cttaaacgtgaagacttgaaccatactggctcacacaaggtaaacaacacgattggtcag
gcgttattggcaaagctttctggtaaaaaacgtattattgccgaaactggtgcagggcag
catggtgtagcgacagcaacaattgcagcacgtttaggtcttgaatgtgttgtttatatg
ggtgctgaagacgttaagcgtcaagcgatgaacgtttaccgtatgcgtttgttaggcgct
acagttgttcctgtacaaagtggctctaaaacgttgaaagacgccatgaacgaagcgatg
cgtgactgggtaactaatgttgatacgacgtactatgtgattggtacggttgcaggcccg
catccatatcctcaattggttcgtgacttccagtcgattattggtcgtgaagcgcgtaaa
cagattttggaacaagcaggtcgtttaccagatgcattagttgcctgtgtaggtggcggt
tcaaatgcaatgggcttgttctatccgtttttaaacgatgccaatgtgaaaatgtatggt
gttgaagccgctggttttggtattgaaactggtaaacactctgcgccgttaaatgcgggt
catgtgggtgtattgcacggtaaccgtacttacttgatgagtgatgaacaaggccagatt
attgagacacatagtatctcagcaggtcttgactatccgggtgttggccctgaacatagc
ttcttgaaagatatgaagcgtgtagagtacgtgccgattaatgatacagaagctctacaa
ggtttccgcgacttaactaaaatcgaagggattattcctgcacttgaaagctcgcatgcg
atggcctatgtctctaagcttgcaccgacgatgtctaaagatcagattattattgcgact
gtttcaggtcgtggtgataaagatttaatgacagttgcacgtattgatggcgtagaaatg
gtcgagatgtaa

DBGET integrated database retrieval system