KEGG   Acinetobacter baumannii AYE: ABAYE0628Help
Entry
ABAYE0628         CDS       T00667                                 

Definition
(GenBank) putative 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00071  Fatty acid degradation
aby00280  Valine, leucine and isoleucine degradation
aby00281  Geraniol degradation
aby00310  Lysine degradation
aby00362  Benzoate degradation
aby00380  Tryptophan metabolism
aby00410  beta-Alanine metabolism
aby00640  Propanoate metabolism
aby00650  Butanoate metabolism
aby00903  Limonene and pinene degradation
aby00930  Caprolactam degradation
aby01040  Biosynthesis of unsaturated fatty acids
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
aby01212  Fatty acid metabolism
Module
aby_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABAYE0628
   00650 Butanoate metabolism
    ABAYE0628
  Lipid metabolism
   00071 Fatty acid degradation
    ABAYE0628
   01040 Biosynthesis of unsaturated fatty acids
    ABAYE0628
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABAYE0628
   00310 Lysine degradation
    ABAYE0628
   00380 Tryptophan metabolism
    ABAYE0628
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABAYE0628
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABAYE0628
   00281 Geraniol degradation
    ABAYE0628
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABAYE0628
   00930 Caprolactam degradation
    ABAYE0628
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ABAYE0628
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABAYE0628
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ABAYE0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 AlaDh_PNT_C DUF5333 Methyltransf_31 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CAM85595
UniProt: B0V4Z9
Position
complement(638512..640647)
Genome map
AA seq 711 aa AA seqDB search
MSAIQYEKNADNIVILTLDSTGQSANTMNAEFRDSLDEVTQKLKAVTELSGVIFRSAKKT
FFAGGDLDELIQVQPEHATDFFNMVEKLKGHLRTIETLGVPVVAALNGTALGGGWEIALS
CHHRIAINDPKSKFGLPEVTLGLLPGGGGIVRMVRLLGLQNAFPFLMEGKQFGVDKAKSL
GLIHDTAENEQELLDKAIAWIKANPKSQQPFDVKGYKIPGGDPKTPAVAQVLAIAPAMLK
DKTKGCYPAPEAIMAAAVEGAQVDVDTALRIESRYFTQLATGQISKNMIGTFWHGLNAIK
SGASRPADIAKWQATKVGVLGAGMMGAGIAYATAIKGIPVILKDVSVENAEKGKAYSQKL
LDKRVSQGRMTAEKRDQILSLITATASAEDLQGCDLIIEAVFENQELKAKVTQEAEQYLA
PNGVMASNTSTLPITGLAQASKNDKAFIGLHFFSPVDKMQLVEIIKGKNTSAETLAKAYD
FVQQIGKTPIVVNDSRGFFTSRVFGTFIQEGMRLLAEGVHPARIEMAALKAGMPVGPLAI
QDEVSLTLTEHVASETRKALQAEGKELPKTPVDEVIHTMIHELNRKGKAAGAGFYDYPEN
GKKHLWEGLNRWQKDHDISEQDMIDRILFVQALDTLRCYEEGVLESVIDANVGSIFGIGY
APWTGGAIQFLNQYGIDKAQKRAEELAAKYGERFTPPTLLKTKAEQKQNIQ
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaattcaatacgaaaaaaatgccgacaatattgtcattttaacgcttgactca
actggtcagtctgcaaataccatgaatgcagaatttcgtgactcgcttgatgaggtcacc
cagaaacttaaagcagtaacagaactttcaggtgttatttttcgctcagcaaaaaaaact
ttctttgctggtggtgatttagatgaactgattcaagttcaacctgagcatgcaactgac
tttttcaatatggttgagaagttaaaaggtcatctaagaacgattgaaacactaggagtt
ccagttgttgcagcattaaatggcacggcactgggcggaggatgggaaatcgcattaagt
tgccatcaccgtattgcaatcaatgacccgaaaagcaaatttggcctaccagaagttacc
ttaggtttactaccgggcggcggtggtattgtacgtatggtccgtctgcttggtcttcaa
aatgcatttccatttttaatggaaggtaagcagttcggtgtcgataaagcaaaatcttta
ggcttaattcatgacacagctgaaaatgaacaagaacttttagataaagcgattgcttgg
atcaaagccaatccaaaatctcaacagccttttgatgtgaagggttataaaattccgggt
ggcgatccaaaaactccggcagttgcacaagttcttgccattgcgccagccatgttaaaa
gacaaaaccaagggctgctatcctgctcctgaagcgattatggctgccgcagttgaaggt
gctcaagttgatgtcgataccgccttgcgcatcgagtctcgctactttactcaactagca
acaggccaaatttctaaaaatatgattggcactttctggcatggtctaaatgcaattaag
tcgggtgctagccgtcctgccgatattgcaaaatggcaagccactaaagtgggcgtgttg
ggtgcgggcatgatgggtgccggtattgcctacgccactgcaattaaaggcattcctgtt
atccttaaagatgtatctgttgaaaatgctgaaaaaggcaaagcttattctcagaaattg
ctagataaacgtgtttcacaaggccgcatgacggcagaaaaacgtgatcagattttatcg
ctcattacggctacagcttctgctgaagacttacaaggttgtgacctgattattgaagcc
gtatttgaaaaccaagaacttaaagcgaaagtcactcaagaagctgaacaatacttagcg
cctaatggtgtaatggcatcaaatacatcaactctaccgattacaggtttagcgcaagca
agcaagaatgataaagcatttattggcctgcatttctttagccctgtcgacaaaatgcaa
ttggttgagattattaaaggtaaaaacacctccgcagagacacttgccaaagcttacgac
tttgtacaacaaattggaaaaacaccgattgttgttaatgatagccgtggtttctttacc
agtcgtgtgtttggtacttttattcaagaaggtatgcgcttacttgcagaaggcgtccat
ccagcgcgtattgaaatggcagcactgaaagctggcatgccggtgggaccacttgcgatt
caagatgaagtgtctttaactttaacggagcatgttgcaagtgaaacacgtaaagcgcta
caagccgaaggcaaagagctaccgaaaacaccagtagatgaagtgattcataccatgatt
catgaattaaaccgtaaaggtaaagctgctggcgcaggtttctatgactatcctgaaaat
ggtaaaaaacacttatgggaaggcttaaaccgttggcaaaaagatcatgatatttctgag
caagatatgattgaccgtattttgtttgtacaagccttagataccttacgttgttatgaa
gaaggggtattagagtcagtgattgatgccaatgtcggttctatttttggaattggttat
gctccgtggacgggaggagcaattcaattcttaaatcaatatgggattgataaagcacaa
aaacgtgccgaagagttggctgccaaatatggtgagcgcttcacgcccccaacgttacta
aaaactaaagctgagcagaagcaaaatattcaataa

DBGET integrated database retrieval system