KEGG   Acinetobacter baumannii AYE: ABAYE0775Help
Entry
ABAYE0775         CDS       T00667                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic subunit (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
aby  Acinetobacter baumannii AYE
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:aby01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aby00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:aby00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:aby00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
794333..794698
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFS
LLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggtttaacaggttcaggttctcgtgattggtttatccagcgtgta
agtgctgtggtattggcagcttatactgttgttctttttggttggatcctctgcaaaggc
ggatttgactatcaacaatgggctggcttcatgatgacattaccaatgaagattttctct
ttattggcaattttgtcgcttatcgcacacgcatggattggtatgtggcaggtttttact
gactatgtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgact
acggctgtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system