KEGG   Acinetobacter baumannii AYE: ABAYE0775Help
Entry
ABAYE0775         CDS       T00667                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00020  Citrate cycle (TCA cycle)
aby00190  Oxidative phosphorylation
aby00650  Butanoate metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
Module
aby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aby_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aby_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABAYE0775 (sdhD)
   00650 Butanoate metabolism
    ABAYE0775 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ABAYE0775 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAM85733
UniProt: B0VEG9
Position
794333..794698
Genome map
AA seq 121 aa AA seqDB search
MKSATGLTGSGSRDWFIQRVSAVVLAAYTVVLFGWILCKGGFDYQQWAGFMMTLPMKIFS
LLAILSLIAHAWIGMWQVFTDYVTTRQMGPSAKGLRLVLTTAVIIAVFVYAIWGIQIFWA
N
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgctacaggtttaacaggttcaggttctcgtgattggtttatccagcgtgta
agtgctgtggtattggcagcttatactgttgttctttttggttggatcctctgcaaaggc
ggatttgactatcaacaatgggctggcttcatgatgacattaccaatgaagattttctct
ttattggcaattttgtcgcttatcgcacacgcatggattggtatgtggcaggtttttact
gactatgtcactactcgtcaaatgggtccttcagcgaaaggtttacgccttgtactgact
acggctgtcattattgcagtgtttgtgtacgcaatctggggtatccagattttctgggcg
aattga

DBGET integrated database retrieval system