KEGG   Acinetobacter baumannii AYE: ABAYE0783Help
Entry
ABAYE0783         CDS       T00667                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00020  Citrate cycle (TCA cycle)
aby00640  Propanoate metabolism
aby00660  C5-Branched dibasic acid metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
Module
aby_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aby_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABAYE0783 (sucC)
   00640 Propanoate metabolism
    ABAYE0783 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ABAYE0783 (sucC)
Enzymes [BR:aby01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ABAYE0783 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAM85739
UniProt: B0VEF2
Position
803522..804688
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKALLKEYGMPVQEGILATNADEAVAAFEQLGGKFAVMKAQVHAGGRGKAGGV
KVAKSKEDVIEFANNIIGTRLVTYQTDANGQPVNSIIVAEDVYPVERELYLGAVVDRSSR
RITFMASTEGGVEIEKVAEETPEKIIKVEVDPLVGLQPFQAREVAFALGLKDKQIGQFVK
IMTAAYQAFVENDFALFEINPLSVRENGEILCVDAKVGIDSNALYRLPKVAALRDKSQEN
ERELKASEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYGGQPANFLDVGGGATKERVI
EAFKIILADTSVQGVLINIFGGIVRCDMIAEAIIAAVQEVNVTVPVVVRLEGNNAELGAK
LLDESGLKLISANGLSDAAEKVVAAVKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgagtatcaagctaaagcgttattgaaagaatatggtatgccggtacaa
gaaggtatcttggcaaccaatgcagacgaagcagttgctgcatttgaacagcttggtggt
aaattcgctgtaatgaaggcgcaagttcatgctggtggtcgtggtaaggctggtggcgtt
aaagttgcaaaatctaaagaagatgttatcgaatttgcaaacaatatcattggtactcgt
cttgtaacgtatcaaacagatgcaaatggtcaaccagtaaacagcatcattgttgctgaa
gacgtatatccagttgagcgtgagctttacttgggcgcggttgtagaccgttctagccgt
cgtattactttcatggcttctacagaaggtggtgtagaaatcgagaaagttgcggaagaa
actccagaaaaaattatcaaagttgaagttgatccattagttggtttacaaccattccaa
gcacgtgaagttgcgtttgctttaggtttgaaagacaagcaaatcggtcaattcgtgaaa
atcatgacagctgcttaccaagcatttgttgaaaatgatttcgctttatttgaaattaac
ccactttcagttcgtgaaaatggcgaaattttatgtgtagacgcgaaagtaggtatcgac
tctaacgcgctttaccgtttacctaaagttgctgctttacgtgacaaatctcaagagaat
gagcgtgaattaaaagcatctgaatttgatcttaactatgttgctttagaaggtaacatt
ggctgtatggttaacggtgctggtcttgcaatggcaactatggacatcattaaactttat
ggtggtcagcctgcaaacttccttgacgttggtggcggtgcaactaaagagcgtgtaatc
gaagcgttcaaaatcattcttgctgatacgtctgtacaaggtgttttaatcaacatcttc
ggtggtatcgtacgttgtgacatgattgctgaagcaattattgcagcggttcaagaagta
aacgtaactgttccagttgttgttcgtttagaaggtaacaacgctgagttaggtgcgaaa
ttacttgatgaatctggtttgaaattaatttctgcgaacggtttgtctgatgccgcagaa
aaagttgtagctgcagttaaagcgtaa

DBGET integrated database retrieval system