KEGG   Acinetobacter baumannii AYE: ABAYE0816Help
Entry
ABAYE0816         CDS       T00667                                 

Gene name
glpk
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aby00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861587..863125
Genome map
AA seq 512 aa AA seqDB search
MCVENERDIHMSNCPKKYIVAFDQGTTSSRAIVLDHDANVVSIAQREFTQIYPQPGWVEH
DPMEIWATQSAVWVEALAQAGIKSEQVAAIGITNQRETTIVWDKKTGRPIYNAIVWQSRQ
TTEICNQLYKAGWQEYIRKTTGLVIDPYFSATKIKWILDHVEGSRERAERGELLFGTVDT
WLIWKLTNGAVHVTDFTNASRTMLFDIEKLEWDEKLLQALDIPRAMLPEVRSSSEVYGYT
HTISGQEVGIPIAGIAGDQQAALFGQMCVESGQAKNTYGTGCFLLMNTGKKIVRSEHGLL
TTIACGASGEVNYALEGAVFNGGSCVQWLRDELKVIKNAKDSELYATRVKDNNGVYVVPA
FTGLGAPYWDPTARGAIFGLTRGASIEHIIRATLESIAFQTRDVLDAMQQDAEEELRTLR
VDGGVTENNFLMQFQADILTTPVERPIMKETTALGAAFLAGLATGFWQDLHELRNKSAIE
KVFEPKMPSEQAELIYKGWLKAVKRSQNWAED
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtggaaaatgaaagggacattcatatgtcaaattgcccgaaaaaatatattgtc
gcttttgatcagggaacaacaagctcaagagcaattgttttagatcatgatgcgaacgtt
gtcagtattgctcaaagagaatttacccagatttaccctcagccaggttgggttgagcat
gatcctatggaaatttgggcaactcaaagtgctgtatgggtcgaagcattggctcaagct
ggcataaagagtgaacaagttgcggcaattggaattacaaaccaacgggaaaccactatt
gtctgggacaaaaaaacaggaagacctatttacaatgcgattgtttggcaaagccgacaa
acaacggaaatatgcaatcaattgtataaagcaggttggcaagaatatatccgtaagact
actggtttagtcattgatccatatttctcggccacaaaaattaaatggattttggatcat
gttgaaggcagtcgtgagcgtgctgaacggggagagttattattcggtacggtggacacc
tggctcatttggaaactaactaatggtgctgttcatgtcactgattttaccaatgcatct
cgaaccatgctgtttgatatcgaaaagcttgagtgggatgaaaaacttttacaagcttta
gatattcctagagcaatgttgccagaggttcgtagttcatctgaggtttatggatataca
cataccattagtggacaagaagtagggatcccaattgccggaatcgcgggtgatcagcag
gctgcgctttttggtcaaatgtgtgttgagtcgggacaggctaaaaatacctacggtact
ggctgttttctactcatgaatacgggtaaaaagattgtccgttcagagcatgggttactc
acaactattgcctgtggtgcgagtggtgaggtgaattatgccttagagggtgccgtattt
aacggtggttcttgcgtacagtggttacgcgatgaattaaaggttattaagaatgctaag
gattccgagctttatgcaacacgtgtaaaggataataatggtgtatatgtagtacctgct
tttaccggattaggagcaccgtattgggacccgacagctcgcggcgcaatttttggtctg
acacgtggggctagtattgaacatattatccgcgcaactctagagtctattgcctttcaa
actcgggatgttttagatgccatgcaacaagatgcagaggaagagcttcgtacactccgt
gttgatggaggagtaacggaaaataatttcttgatgcaatttcaggccgatattttaacg
acaccggtagagcgtccaataatgaaagaaactacagcattgggtgcagctttcttagca
gggttggccactggtttttggcaagatcttcatgagttaagaaataaatctgccatagaa
aaggtttttgaaccgaaaatgccttctgaacaagctgaactcatttataaaggttggcta
aaagcagttaagcgtagtcaaaattgggcagaggattga

DBGET integrated database retrieval system