KEGG   Acinetobacter baumannii AYE: ABAYE0910Help
Entry
ABAYE0910         CDS       T00667                                 

Gene name
ruvA
Definition
(GenBank) holliday junction helicase subunit A
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aby00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABAYE0910 (ruvA)
Enzymes [BR:aby01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ABAYE0910 (ruvA)
DNA repair and recombination proteins [BR:aby03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ABAYE0910 (ruvA)
    RecFOR pathway proteins
     ABAYE0910 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(968068..968667)
Genome map
AA seq 199 aa AA seqDB search
MIGCLIGEVFALEAPTVLLNVNGVGYEIDTPLSTFCQLQKGQKVTLWTHLVVREDAQQLY
GFSDAQEKTIFRTLLKVNGVGPKMALGILSTLSVELLVHTIEHDDVNTLVKVPGVGKKTA
ERLMIELRDRFKTLAQGTSSAAALPQIQFVSNSPVAEAEAALQSLGYKPLEAQKAVAAVK
ADYTESADIIRAALKSMMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatgtttaattggcgaagtgtttgccctagaagccccaactgtcttactgaat
gtaaatggtgtgggctatgaaattgatacaccactttcaacattttgccaattacaaaaa
ggccagaaagttacgctatggacgcatttggtcgtccgtgaagatgctcagcagctttat
ggttttagtgatgctcaagagaaaactattttccgcaccttactaaaagtaaatggtgtg
ggcccgaaaatggcattaggtattctttctacgttaagtgttgaattgctggtacacaca
attgaacatgacgatgtgaatactttggttaaagttccgggtgtaggcaaaaaaacagct
gaacgtttaatgattgaacttcgtgaccgttttaaaactttggcacaaggaacttctagc
gctgccgccctgcctcagattcaatttgtttcgaactcacctgttgcagaagcagaagca
gccttacagtcactaggttataaacctcttgaggcacaaaaagctgttgcggcggttaaa
gccgattacactgaatcagccgatattattcgtgctgcacttaaatcaatgatgaagtaa

DBGET integrated database retrieval system