KEGG   Acinetobacter baumannii AYE: ABAYE1343Help
Entry
ABAYE1343         CDS       T00667                                 

Gene name
desC
Definition
delta 9 acyl-lipid fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABAYE1343 (desC)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABAYE1343 (desC)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     ABAYE1343 (desC)
Lipid biosynthesis proteins [BR:aby01004]
 Desaturase
  First
   ABAYE1343 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402812..1403783
Genome map
AA seq 323 aa AA seqDB search
MSKFFLRWIDSWSDSENAQVGASSEYVIEKKIQWLRIIPFILLHIACLAAFWVGVSWFAV
IFMLGFYFLRMFAITAFFHRYLSHKTFQTSRIVQFIFVLIGTMSAQRGPLWWAAHHRYHH
HFTDTDQDPHSAKAGFWYSHVGWFLNEQNFATRKKVIKDWLKYPELIWLDRFSLPIVILT
ALAIYGLGSWLAQHFPELGTNGLQLLVWGFVISTVLLTHATLCINSLAHRYGSREFNTPD
DSRNNFLLSLITLGEGWHNNHHFYAGSVRQGFYWWQIDITFYVLKLMSLFGLVWGLKPVP
DKVYQYKKIKNLSIEKIENGEVL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattttttctgcgctggatcgatagctggtcagattcagaaaatgcgcaagtg
ggtgcttctagcgaatatgtcattgaaaagaaaattcaatggttaagaattattcctttt
attttattacatatcgcttgtttagctgcattttgggtgggcgtatcttggtttgctgtg
atcttcatgctggggttttattttcttcgcatgtttgcaattactgcttttttccaccgc
tatctttcgcataaaacttttcagacatcacgtattgttcaattcatttttgtactgatc
ggaaccatgagtgcgcagcgcggacctttatggtgggcagcccatcaccgttatcaccat
cactttaccgacaccgatcaggacccgcattcagcaaaagcaggcttttggtattcgcat
gtaggctggtttttaaatgagcaaaattttgctactcgaaaaaaagtcattaaagactgg
ttgaaatatccagagctgatttggctagaccgatttagtttgcctattgtgattttgacg
gccttagcaatttatggattaggttcatggcttgcacaacatttccctgagttgggcacc
aatggtttacagcttttagtgtggggatttgtgatttccactgttctattaacacatgca
accttgtgtattaattcactcgctcatcgttatggttcacgtgagtttaacaccccagat
gatagccgtaataacttcctactttctttaattaccttgggtgaaggatggcataacaat
catcacttttacgcaggcagtgtgcgtcaaggtttttattggtggcagatagatatcact
ttttatgtgctcaagctgatgtctttatttggtttagtgtggggcctaaagcccgtacca
gacaaggtttatcaatataaaaagattaaaaacctatcgatagaaaaaattgaaaacggt
gaagtgttatga

DBGET integrated database retrieval system