KEGG   Acinetobacter baumannii AYE: ABAYE1413Help
Entry
ABAYE1413         CDS       T00667                                 

Definition
(GenBank) putative acetyl-CoA synthetase/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00010  Glycolysis / Gluconeogenesis
aby00620  Pyruvate metabolism
aby00640  Propanoate metabolism
aby00680  Methane metabolism
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABAYE1413
   00620 Pyruvate metabolism
    ABAYE1413
   00640 Propanoate metabolism
    ABAYE1413
  Energy metabolism
   00680 Methane metabolism
    ABAYE1413
Enzymes [BR:aby01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABAYE1413
Lipid biosynthesis proteins [BR:aby01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABAYE1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAM86323
UniProt: B0V7E7
Position
1470701..1472344
Genome map
AA seq 547 aa AA seqDB search
MKTLAEAYQQFDLTRLIEEQLVGHPQAINAYVECCERYVGKNKTALIWEGKNGQAEHYTF
EQLAELSGKLANFFKAQGIQAGDCIAGLLPRTPELLITILAAWRIGAIYQPLFTAFEAKS
IDHRITTAQTKLIVTNDEQRPKLNTLNVPVIVTVHQTGLLSEHDFDFWQSLQRYSEQCEP
VNRSFDDDFLMMFTSGTTGLAKSVPVPLKAILAFKGYMTHAVDLREEDMFWNLADPGWAY
GLYYGITGPLSLGHGIIMDERSFNVDQAIELIKKYKVSNLTGSPTAFRMFFGFKEKFDPS
IKQHLRVVSSAGEPLTPEVVNWFKQDLEVNIFDQYGQTELGMVIANHHALEHPLKVGSAG
FAIPGHRFAVLDQNYQELPTGGVGILAMDSEQSPLMWFKGYGGNNRKAFVGKYYLTGDTV
TLNEHGGIDFVGRADDVITTSGYRVGPFDVESTLLECEAVLESAVIGKPDPERTEIVKAF
VVLKPAYQACETLKDKLQQYVRNRLSRHAYPKEIEFVDSLPKTTSGKIQRGLLKQQEIAK
MQQAYAS
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttggcagaagcttatcagcaatttgatcttacaaggctcatcgaagagcaa
cttgttgggcatccccaagcaataaatgcttatgttgagtgctgtgagcgttatgtagga
aaaaataaaacagcgcttatctgggaaggaaaaaacgggcaggcagagcactatacgttc
gaacaacttgctgaactttctggaaaacttgctaacttctttaaagcacaaggaattcaa
gctggagattgtattgcaggacttctaccaagaacgcctgagttattaattacaattttg
gcagcatggcgtataggcgctatttatcagcctttatttactgcctttgaagcaaaatcg
attgatcaccgaattacgactgctcaaactaaattgattgtgaccaatgatgaacagcgc
cctaaactgaataccttgaatgttccggttattgtaactgttcatcaaacaggtctttta
tctgagcatgactttgatttttggcaatctttacaacgatattctgagcaatgtgagcca
gtaaatcgtagctttgatgatgactttttaatgatgtttacctcaggcacaactggactt
gcaaagtctgtacctgttccactaaaagcaattttagcatttaaaggttatatgacccat
gccgttgatttgcgtgaagaggatatgttctggaatctggcagatccgggctgggcatat
ggattgtattatggcattaccgggcctttaagcttgggtcatggcattattatggatgag
cgttcatttaatgtagatcaggcaatagaattaattaaaaaatataaagtaagtaattta
acaggatcgcctacagcatttcgcatgttctttggatttaaggaaaaatttgacccttca
attaaacaacatttacgcgtagtgagtagtgcaggtgagccattaactcctgaggttgtg
aattggtttaagcaggatttagaggtcaatatttttgatcaatatggccaaactgagcta
ggcatggtaattgcgaaccaccatgcgcttgagcatccattaaaagtaggttcagctggt
tttgcaattcctgggcatcgttttgcggtgttagaccaaaattatcaagaattgccaact
ggtggtgttggtattttggcgatggactcggagcaatcgccattaatgtggtttaaaggt
tatggtggcaataatcgcaaagcctttgttggtaagtattatttaacaggtgacacggtc
actttaaatgaacatgggggcattgattttgtggggcgtgctgacgatgtcattacaact
tcgggttatcgagttggaccatttgatgttgaaagtactttattagagtgtgaggccgta
ttggagtcagcagtaattggtaagccagatccggaacgaaccgaaatagtcaaagctttt
gtggtacttaagcctgcttatcaagcgtgtgaaacattaaaagataagttacagcaatat
gttcgtaaccgtttatctcgtcatgcttatccaaaagagattgagtttgtggacagtcta
ccgaaaaccacgagcggaaaaattcaaagaggactgttgaagcagcaagaaattgcaaaa
atgcagcaagcctacgcaagctaa

DBGET integrated database retrieval system