KEGG   Acinetobacter baumannii AYE: ABAYE1522Help
Entry
ABAYE1522         CDS       T00667                                 

Definition
(GenBank) putative iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00010  Glycolysis / Gluconeogenesis
aby00071  Fatty acid degradation
aby00350  Tyrosine metabolism
aby00625  Chloroalkane and chloroalkene degradation
aby00626  Naphthalene degradation
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABAYE1522
  Lipid metabolism
   00071 Fatty acid degradation
    ABAYE1522
  Amino acid metabolism
   00350 Tyrosine metabolism
    ABAYE1522
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ABAYE1522
   00626 Naphthalene degradation
    ABAYE1522
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ABAYE1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAM86424
UniProt: B0V741
Position
complement(1587342..1588499)
Genome map
AA seq 385 aa AA seqDB search
MSHFQFQTVPNIISGLGSIQELQNVLASKTYRKLLLVTDAGMIKNQLHLPILQILDTLKI
EHVIYADVQADPPEQVVLDAANYAKQQNVDVIVGFGGGSSLDVAKVIALLAHPNQTQNLQ
EMYGINQVKTARLPLILIPTTAGTGSEVTPISIVTTGETTKMGIVSPVLYADTAILDATF
TQNLPAHITAATGIDAMVHAIEAYTSKHKKNIYTDILAKHALKLLNHNLPKVLKNGNDLE
ARQNMLFGSMLAGQAFANSPVAAVHALAYPLGGHFHLSHGHTNALVLVEVLKFNAPYAKQ
YYAELMQWLDPYSNGSTDGLCDLFIDHMQNHLDRSGLTLKLSDLSIEESSLPRLAQDAML
QTRLLQNNPRDMTEAAALAIYQAIY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagccattttcaatttcagaccgttcccaacattatttcaggactcggttctatacaa
gaattacagaatgtgttggcatcaaaaacttaccgcaagttattattggtaactgatgcg
ggtatgattaaaaatcagttacacctgcctattcttcaaattttagatactcttaaaatt
gaacatgtcatttatgctgatgttcaggccgacccaccagagcaagtggtattagatgca
gcaaattatgctaaacagcaaaatgtagatgttattgtcggctttggaggcggaagttct
ttagatgtagccaaagtgattgccttactcgcacatcccaaccaaactcaaaacctacaa
gaaatgtacgggataaatcaggtcaaaacagcccgacttccacttattttaattcccact
acagccggtactggctcggaagtgacacccatatcaatagtgactacaggtgaaacgaca
aaaatgggaattgtctctccggtactctatgccgatacagcaattcttgatgcaactttt
actcaaaatctacctgcccatattacggctgctacaggtattgatgcgatggtccatgcc
attgaggcatatacctctaaacataagaaaaatatttataccgatattttagcgaaacac
gctttaaagctactgaaccataacttaccgaaagttcttaaaaacggtaatgatttagag
gcacgtcagaacatgctgttcggctcaatgcttgcgggtcaggcatttgcaaactcacct
gttgctgccgtgcatgctttagcctatccattaggtggacattttcatttgtcgcatgga
cataccaatgctttggtgctcgttgaagtactgaaatttaatgcgccctatgccaaacaa
tactatgcagaacttatgcaatggctagacccatatagtaatggcagcaccgatggtttg
tgtgatctatttattgaccatatgcaaaatcacttagaccgtagtggtttgactttaaaa
cttagcgatttgagtattgaagagtctagcttaccaagacttgctcaagatgccatgttg
caaactcgattactgcaaaataatccacgtgacatgacagaagcagctgctttagcaatt
tatcaggcgatttattaa

DBGET integrated database retrieval system