KEGG   Acinetobacter baumannii AYE: ABAYE1646Help
Entry
ABAYE1646         CDS       T00667                                 

Definition
phospholipase A1 (PldA) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:aby00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:aby00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:aby00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:aby00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:aby00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1706623..1707774
Genome map
AA seq 383 aa AA seqDB search
MAFRQFERTSLQLSMGTLLSCLCASVAYADTLAPVKPASVDACVALASNADRLACYDAVF
KPSALPVVQAAVVPEPVKKIDKPVVQPETFKEKVVDKVSNIKVIGKAPTIEPTSSLLDQR
WELSEKSKLGVWNIRAYQPVYLLPVFWTSDKNEFPSSPNPNNTVTEAQNLKSTESKFQIS
LKTKAWENIFGNNGDLWVGYTQSSRWQTFNAEESRPFRETNYEPEASLMFRTNYELLGLD
GRLLGVTLNHQSNGRSDPLSRSWNRVIFNVGLERGNFALMLRPWIRIEEDSKDDNNPDME
DYIGRGDLTAFYKWKQNDFSLMLRHSLKGGDDSHGAVQFDWAFPISGKLRGHFQLFNGYG
ESLIDYNHRATYAGLGVSLMNWY
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcagacaatttgaacgcacatctttacagctaagtatgggaaccctgcttagc
tgtttatgtgcgtcggtggcatatgccgacaccttagcccctgtaaaacctgcgagtgta
gatgcatgtgttgcccttgcttcgaatgctgatcgcctagcttgttatgatgctgtgttt
aaaccatcggccttaccggttgttcaagccgcagtagtaccagagcctgttaaaaaaatt
gataaacctgttgttcaacctgaaacatttaaagaaaaggttgtagataaggtaagtaat
atcaaagtaattggtaaagcacctacaattgaacctacttcttctttgctagatcaacgt
tgggagttgtctgaaaaaagcaaactgggtgtttggaatattcgtgcttatcaacctgtt
tacttgctaccagttttctggacgagcgataaaaatgagtttccaagcagtccaaaccca
aataatacggtgacagaagcccaaaaccttaaatcaactgaaagtaaattccagatttct
ttgaaaacgaaagcttgggaaaatatttttggtaacaatggtgacttgtgggtaggttat
actcaatcttcacgttggcagacctttaatgctgaagaatctcgtccattccgtgaaacg
aactatgagccagaagcaagtttaatgtttagaacaaactatgagttgcttggcttagat
ggtcgtttgcttggggtaactttaaatcaccagtcaaatggacgttcagatcctttatct
cgtagctggaaccgtgtcatctttaatgtgggtttagaacgcggtaactttgctttaatg
cttcgtccatggatacgcattgaagaagacagcaaagatgataataatccagatatggaa
gattacatcggtcgtggtgatttaactgctttttataagtggaagcaaaatgacttctca
ttaatgctacgtcactctttaaaaggtggtgatgattctcatggtgctgttcagtttgac
tgggctttcccgattagtggcaagctgcgcggacacttccaattatttaatggttatggt
gaaagcttaattgactataaccatcgtgcaacttatgccggtttgggtgtttcactcatg
aactggtactaa

DBGET integrated database retrieval system