KEGG   Acinetobacter baumannii AYE: ABAYE1955Help
Entry
ABAYE1955         CDS       T00667                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aby01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aby00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aby00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2013914..2015119)
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFHAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGNEIKEQTHHRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLETHMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSTATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREASKLPKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccgaatgaacaaggattttttggtgaatat
ggagggcaatttattcctccacatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttatttcatgcaaaacgcctttcagaacagttaggtggcgcg
caaatttatttaaagcgtgaagacttaaatcataccggtgcccacaaaattaatcactgt
ttaggtgaggctctacttgccaaatatatgggcaaaaagaaagtcattgccgagactggt
gcgggacagcatggcgttgctttagcaacggcttgtgctttagttggtattccatgtgaa
attcacatgggtcaagtagatattgaaaaagaacaccctaatgtggtcaaaatgaaaatt
ttgggtgctcatttagtttcagtaacacgtggtacagcaaccttaaaagatgcagtggat
agcgcttttgaagaatatttaaaagaccctaaaaactttatttatgcaattggttctgtg
gttggaccacatccatttccaaaaatggttcgagattttcaatcgattattggtaatgaa
attaaagagcagacgcatcatcgttttggtaaaaacccagattatgttgtcgcatgtgtt
ggtggcggttcaaatgcaatcggtgcctttacagcatttctaaatgattcggatgtgaaa
ttggttggggttgaaccagcaggacatggtttagaaactcacatgcattcggcaacttta
accttaggtaaaccaagtcaaattcatggtatggcgtgttacgtgcttgaaaatgaagct
ggtgaaccgttacccgtgcattctattgcttcaggattggactatcctggtgttgggcca
cagcatagtttcttaaaagatttaggccgtgtggaatatagcactgcaactgaccaagaa
tgtttggatgcttttatgaccttatctcgtgtagaaggaattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgtcaaagctgccgaaagaaaccatgatc
gtggtgaatctatcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system