KEGG   Acinetobacter baumannii AYE: ABAYE2037Help
Entry
ABAYE2037         CDS       T00667                                 

Gene name
cysQ
Definition
(adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:aby00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2092103..2092960)
Genome map
AA seq 285 aa AA seqDB search
MFITTTCPNDALIEQLLPILEEASQILLQEYQNYSAGYEFTIEEKHDDSPVTQADLKVNR
FLLKHLAEITPELPVLSEESDYSARHAWSSCWMLDPLDGTKEFIHERDEFTINLSLIEGR
ETIFSVIVVPCEQVVYLGYLKDLPFKYSFSQQQWYQYQKTPYSKQAPVQIGLSHSSKNPK
YQKFIEPIEKIRTVIRREAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQGLLESIGGG
LLTLTGKPFEYNQRDTVLNGGFIAFRDQESKKIAFEALAQSGVLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaacaacttgccccaatgatgctttaattgaacagctactaccaatcttg
gaagaagctagccaaatcttattacaagaatatcaaaattattcggctggatatgaattt
acgattgaagaaaaacatgatgattcacctgtaacgcaagcagatttaaaggtaaatcgt
tttttattaaagcatcttgcagaaattacacctgagttaccagttttatcggaagaaagt
gactatagtgctcgccatgcttggtcttcttgctggatgctagatccacttgatggtacg
aaagagtttatacatgagcgagatgagttcacgataaacttgagtttgattgaagggcgt
gaaacgattttttcggtgattgttgtgccatgtgaacaggtcgtttatttaggttattta
aaggatttaccctttaaatatagctttagccaacaacaatggtatcaatatcaaaaaaca
ccttattcaaaacaagctcctgtacaaattggtttaagtcatagtagtaaaaatccgaaa
tatcagaaattcattgaacctattgaaaagattcgtaccgtaattcgtcgtgaagcgggt
agcgcttataagttttgtatgatgttagaaggcgagatcgatatttatcctagatttcat
ccgacatcagaatgggataccagctcaggtcaaggattattagaaagtataggtggaggt
ttactcactctaacaggtaagccctttgaatataaccaacgtgataccgtattaaatggg
ggctttatcgcatttcgtgatcaggaaagcaaaaaaatagcatttgaagctttagctcaa
tcaggtgttttggattga

DBGET integrated database retrieval system