KEGG   Acinetobacter baumannii AYE: ABAYE2053Help
Entry
ABAYE2053         CDS       T00667                                 

Gene name
glcB
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABAYE2053 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABAYE2053 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ABAYE2053 (glcB)
Enzymes [BR:aby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ABAYE2053 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2110378..2112543)
Genome map
AA seq 721 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALPGSGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNKFELGAYKAFLTEIGYLLPEVEDFQITTENVDEEIALLAGPQLVVPVRN
ARYCLNAANARWGSLYDALYGFDVISEEGGAEKGKGYNPVRGAKVIEFAKNFLNEIFPLA
QGSHADATKYAIEQNKLVVTLKDGTKTGLAHEAQFVGFNGEEANPSEVVLLSNGLHVIIE
IDANSPIGQTDLAGVKDLTLEAAVTTIQDLEDSVAAVDAEEKVEGYRNWLGLMKGTLQES
IEKNGKTIVRALNKDREIKNLIGGTTKLHGRSLMLLRNVGHLMTNPAILVDGEEIFEGIM
DALVTPLLSIADIRSENENKNSRKGSMYIVKPKMHGPEEVAFAVELFERAEQALGLPAKS
LKIGIMDEERRTSVNLKNCIAAAKDRTIFINTGFMDRTGDEIHTSMEAAPVVRKEAVKTQ
KWIAAYENRNVAIGLKCGLQGKAQIGKGMWPKPDSMKDMLATKAAHPNAGASCAWVPSPT
GAVLHAMHYHQVNVKARQDQLKAEEMLSLDDLLTPPFATDTNWSAEEINNELENNCQGIL
GYVVRWVDLGVGCSKVPDINNVGLMEDRATLRISSQHVANWLRHGIVTREQVEEVLKRMA
KIVDEQNANDPLYKPMAANFETNIAFQAASDLIFKGCEQPSGYTEPLLHAARLKLKGYTG
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatc
gaaaatgaagctttaccaggttctggtttagatagtgaaacttactggaagaactttgag
caagttgttgtcgaccttagtccaaagaataaagcattattggctaagcgtgatgaatta
caagcaaaaattgatgaatggcaccgcaacaataaatttgaattaggtgcttacaaagca
tttttaactgaaattggttatttattaccagaagttgaagacttccaaattactactgaa
aacgtagatgaagaaattgcattgttagcaggcccacaattagtagtacctgtacgtaat
gcacgttattgcttaaatgcagcaaatgcacgctggggttctttgtacgatgcactttac
ggcttcgatgtaatttcagaagaaggcggtgcagaaaaaggaaaaggatataaccctgta
cgtggtgcgaaagttattgagtttgctaaaaacttcttaaatgaaattttcccgcttgcg
caaggctcacatgctgatgcaactaaatatgcaatcgagcagaataaactcgttgtgact
ttaaaagatggtactaaaactggcttagctcatgaagctcagtttgtgggtttcaatggt
gaagaagcgaacccttcagaagttgttcttttgagtaatggcttacatgtcattattgaa
attgatgcgaatagcccaattggccaaactgatttagcgggtgttaaagatctaacactt
gaagctgcggttacaacaattcaggatcttgaagactctgtagcagctgttgatgcagaa
gaaaaggttgaaggttatcgtaactggttaggtttgatgaagggcactcttcaagaatct
atcgaaaaaaatggtaaaacaattgttcgcgctttgaataaagaccgtgaaattaaaaat
ttgatcggtggcacaacaaaacttcatggtcgttcacttatgttacttcgtaacgtaggt
catttaatgacgaatccagcgatattagttgatggtgaagaaattttcgaaggtattatg
gatgcgttggtaacgccattgttatcaattgctgacatccgtagtgaaaacgaaaataaa
aactctcgtaaagggtctatgtatattgttaaaccaaaaatgcatggccctgaagaagtt
gcttttgctgttgagttatttgagcgtgctgagcaagccttaggattaccagcgaagtct
ttaaaaatcggtattatggatgaagaacgccgtacatctgtaaacttgaaaaactgtatt
gctgctgctaaagatcgcacaatctttattaacactgggttcatggaccgtactggtgat
gaaatccatacttctatggaagctgctccagttgttcgtaaagaagcggttaaaacacaa
aaatggattgctgcttacgaaaaccgtaacgttgcaatcggtttgaaatgtggtttacaa
ggtaaagcacagattggtaaaggcatgtggccaaaaccagatagcatgaaagatatgttg
gcaactaaagctgctcatccaaatgctggtgcttcatgtgcttgggttccatcaccaact
ggtgctgtacttcatgcgatgcattaccatcaagtaaatgtaaaagcacgtcaagatcag
ttaaaagctgaagaaatgttgtcattagatgacttgttaactcctccatttgcaactgat
acaaactggtcagcagaagaaattaataacgagctcgaaaataactgccaaggtatttta
ggttacgttgtgcgttgggttgacttaggtgtaggttgttcaaaagttcctgatattaac
aacgtgggcttaatggaagaccgtgcaacattacgtatttcttctcaacatgttgccaac
tggttacgtcacggtatcgtgactcgtgaacaagttgaagaagtgcttaaacgcatggca
aaaattgttgatgaacaaaatgcgaatgatccattgtataaaccaatggcagctaacttt
gaaactaatattgctttccaagcagcttcagaccttatctttaaaggttgtgaacagcct
tctggttatactgagccattactacatgcggctcgtttaaaattaaaaggttatacaggt
gactaa

DBGET integrated database retrieval system