KEGG   Acinetobacter baumannii AYE: ABAYE2307Help
Entry
ABAYE2307         CDS       T00667                                 

Gene name
dcaF
Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABAYE2307 (dcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    ABAYE2307 (dcaF)
   00640 Propanoate metabolism
    ABAYE2307 (dcaF)
   00650 Butanoate metabolism
    ABAYE2307 (dcaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ABAYE2307 (dcaF)
   00072 Synthesis and degradation of ketone bodies
    ABAYE2307 (dcaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABAYE2307 (dcaF)
   00310 Lysine degradation
    ABAYE2307 (dcaF)
   00380 Tryptophan metabolism
    ABAYE2307 (dcaF)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABAYE2307 (dcaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABAYE2307 (dcaF)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ABAYE2307 (dcaF)
Enzymes [BR:aby01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABAYE2307 (dcaF)
Exosome [BR:aby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABAYE2307 (dcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2353869..2355074
Genome map
AA seq 401 aa AA seqDB search
MLNAYIYDGLRSPFGRHAGELASIRPDDLAATVIQKLLEKTGVPGADIEDVILGDTNQAG
EDSRNVARNALLLAGLPVTVPGQTVNRLCASGLGAVIDSARAITCGEGELYIAGGVESMS
RAPFVMGKAESAYSRDAKIYDTTIGSRFPNKKIIAQYGGHSMPETGDNVAAEFGISREQA
DLFAAQSQAKYQKAKEEGFFVDEITPIEVFQGKKLPPKLVSEDEHPRPSSTVEALTKLKP
LFEGGVVTAGNASGINDGAAALLIGSEAAGQKYGLKPMAKILSAAAAGIEPRIMGAGPIE
AIKKAVARAGLTLDDMDIIEINEAFASQVLSCLKGLNVDFNDPRVNPNGGAIAVGHPLGA
SGARLALTVARELIRRKKKYAVVSLCIGVGQGLAMVIENVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatgcatatatctatgatggtttgcgtagtccatttggccgtcatgcgggtgaa
cttgcctcaattcgtcctgatgatttagcagcaacggtcattcaaaaactacttgaaaaa
actggtgtaccgggcgcggatattgaagatgtgatcttaggcgacaccaaccaagcgggt
gaagacagtcgtaatgtggcacgcaacgcgctgttacttgcaggtttacctgtcactgtg
ccaggccagacagtaaaccgtctatgtgcgagtggtttaggtgcagtaattgattcagca
cgtgctattacttgtggtgaaggtgagctctatatcgcaggtggtgtagaaagtatgtct
cgcgcaccttttgtgatgggtaaagccgaaagtgcttatagccgtgatgcaaaaatttat
gacaccaccattggttctcgctttcccaataaaaaaattattgcgcagtacggcggtcat
tcaatgcctgaaacgggcgataacgttgcagccgagtttgggattagccgtgaacaagcc
gacttatttgcagctcaatcacaagccaaatatcaaaaagccaaagaagaaggtttcttt
gtcgatgaaattaccccaattgaggttttccaaggcaaaaaattgccacctaaactcgtt
tctgaagatgaacaccctcgtccaagctcaactgttgaagcactcacaaagttaaaacca
ctctttgaaggtggcgtggttacagctggtaatgcttcaggtattaatgatggtgcagca
gcactcttgattggttcagaagcagcgggtcaaaaatatggcctaaaaccaatggcaaaa
atcttgtccgctgcggcggctggtattgagccacgcattatgggtgcaggtcctattgaa
gccattaaaaaagctgttgcgcgcgctggccttactttagatgacatggatattattgaa
attaatgaagcctttgcttcacaggttttatcttgtttaaaaggcttaaatgttgatttt
aatgacccacgtgtgaacccgaacggtggcgcaattgctgttggtcatccacttggtgct
tcaggcgctcgtcttgcgttaacagtagcgcgcgagttaattcgccgtaagaagaaatat
gccgtggtgagcctatgtattggtgtaggtcagggtcttgcaatggtgattgaaaacgtt
tcataa

DBGET integrated database retrieval system