KEGG   Acinetobacter baumannii AYE: ABAYE2370Help
Entry
ABAYE2370         CDS       T00667                                 

Gene name
paaF
Definition
enoyl-CoA hydratase, phenylacetic acid degradation (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ABAYE2370 (paaF)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABAYE2370 (paaF)
   00650 Butanoate metabolism
    ABAYE2370 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ABAYE2370 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABAYE2370 (paaF)
   00310 Lysine degradation
    ABAYE2370 (paaF)
   00360 Phenylalanine metabolism
    ABAYE2370 (paaF)
   00380 Tryptophan metabolism
    ABAYE2370 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABAYE2370 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABAYE2370 (paaF)
   00281 Geraniol degradation
    ABAYE2370 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABAYE2370 (paaF)
   00627 Aminobenzoate degradation
    ABAYE2370 (paaF)
   00930 Caprolactam degradation
    ABAYE2370 (paaF)
Enzymes [BR:aby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABAYE2370 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2412885..2413658)
Genome map
AA seq 257 aa AA seqDB search
MQELIKASTAADGVLLLTLNRPEKRNALNNATLQCLCELLEEAEHNAQVKAVVLTGNAQC
FAAGADLSELAAMDAVSLQLDIRPKLWQKIDAFSKPLISAVNGYALGAGFELVLHSDMVI
CGENARFALPEIGLGMLPGAGGTQRLARLVGQQLTMRWAMTGEMISAKQAEQHGICSQVV
PTELTVEYVVQLAAKIAKQAPLAIRVIKQSIKSIHETTLSQGLKFERQNFVWLAATKDRN
EGINAFFEKRKPVFRGE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagttgatcaaagccagcacagctgctgacggtgttttgttattaaccctaaac
cgtccagaaaaaagaaatgccttaaacaatgcaacattgcagtgtttgtgcgagttgctc
gaagaagctgaacataatgctcaagtcaaagcagtggttttaacaggtaacgctcaatgt
tttgcggctggagcagatctaagtgagttggctgcaatggatgccgtgtctttgcaactc
gatattcgcccgaagctttggcaaaaaattgatgcgtttagtaagccactcattagcgca
gtcaatggctatgccttaggcgctgggttcgaattggttttgcattcagatatggtgatt
tgcggtgaaaatgcccgttttgctttacctgaaattggccttggcatgttgccgggtgca
ggcggaacgcagcgtttagcacgcttggtaggacaacaacttaccatgcgctgggccatg
acaggtgagatgatttcggcaaaacaggcggagcaacatggcatttgcagtcaagtggtt
ccgaccgaattaaccgttgaatatgtggttcaacttgcagccaaaattgctaaacaagcg
cctttagcgattcgcgtgattaaacaatcaattaaaagtattcatgaaacaacgttaagt
cagggactcaagtttgaacgtcaaaactttgtctggctggcggctacaaaagatcgaaac
gaagggattaatgctttctttgagaaaagaaagccagtgtttagaggtgagtga

DBGET integrated database retrieval system