KEGG   Acinetobacter baumannii AYE: ABAYE2370Help
Entry
ABAYE2370         CDS       T00667                                 

Gene name
paaF
Definition
(GenBank) enoyl-CoA hydratase, phenylacetic acid degradation
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00071  Fatty acid degradation
aby00280  Valine, leucine and isoleucine degradation
aby00281  Geraniol degradation
aby00310  Lysine degradation
aby00360  Phenylalanine metabolism
aby00362  Benzoate degradation
aby00380  Tryptophan metabolism
aby00410  beta-Alanine metabolism
aby00627  Aminobenzoate degradation
aby00640  Propanoate metabolism
aby00650  Butanoate metabolism
aby00903  Limonene and pinene degradation
aby00930  Caprolactam degradation
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01212  Fatty acid metabolism
Module
aby_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABAYE2370 (paaF)
   00650 Butanoate metabolism
    ABAYE2370 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    ABAYE2370 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABAYE2370 (paaF)
   00310 Lysine degradation
    ABAYE2370 (paaF)
   00360 Phenylalanine metabolism
    ABAYE2370 (paaF)
   00380 Tryptophan metabolism
    ABAYE2370 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABAYE2370 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABAYE2370 (paaF)
   00281 Geraniol degradation
    ABAYE2370 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABAYE2370 (paaF)
   00627 Aminobenzoate degradation
    ABAYE2370 (paaF)
   00930 Caprolactam degradation
    ABAYE2370 (paaF)
Enzymes [BR:aby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABAYE2370 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAM87220
UniProt: B0VB52
Position
complement(2412885..2413658)
Genome map
AA seq 257 aa AA seqDB search
MQELIKASTAADGVLLLTLNRPEKRNALNNATLQCLCELLEEAEHNAQVKAVVLTGNAQC
FAAGADLSELAAMDAVSLQLDIRPKLWQKIDAFSKPLISAVNGYALGAGFELVLHSDMVI
CGENARFALPEIGLGMLPGAGGTQRLARLVGQQLTMRWAMTGEMISAKQAEQHGICSQVV
PTELTVEYVVQLAAKIAKQAPLAIRVIKQSIKSIHETTLSQGLKFERQNFVWLAATKDRN
EGINAFFEKRKPVFRGE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagttgatcaaagccagcacagctgctgacggtgttttgttattaaccctaaac
cgtccagaaaaaagaaatgccttaaacaatgcaacattgcagtgtttgtgcgagttgctc
gaagaagctgaacataatgctcaagtcaaagcagtggttttaacaggtaacgctcaatgt
tttgcggctggagcagatctaagtgagttggctgcaatggatgccgtgtctttgcaactc
gatattcgcccgaagctttggcaaaaaattgatgcgtttagtaagccactcattagcgca
gtcaatggctatgccttaggcgctgggttcgaattggttttgcattcagatatggtgatt
tgcggtgaaaatgcccgttttgctttacctgaaattggccttggcatgttgccgggtgca
ggcggaacgcagcgtttagcacgcttggtaggacaacaacttaccatgcgctgggccatg
acaggtgagatgatttcggcaaaacaggcggagcaacatggcatttgcagtcaagtggtt
ccgaccgaattaaccgttgaatatgtggttcaacttgcagccaaaattgctaaacaagcg
cctttagcgattcgcgtgattaaacaatcaattaaaagtattcatgaaacaacgttaagt
cagggactcaagtttgaacgtcaaaactttgtctggctggcggctacaaaagatcgaaac
gaagggattaatgctttctttgagaaaagaaagccagtgtttagaggtgagtga

DBGET integrated database retrieval system