KEGG   Acinetobacter baumannii AYE: ABAYE2620Help
Entry
ABAYE2620         CDS       T00667                                 

Definition
(GenBank) putative Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    ABAYE2620
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     ABAYE2620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 Pyr_redox Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: CAM87454
UniProt: B0VAF9
Position
2654111..2655781
Genome map
AA seq 556 aa AA seqDB search
MTINNYDYDYLIIGSGFGGSVSACRLTEKGYSVAVMEMGRRWKAEDFAKNNWNTRRWIWR
PGMKLFGYFNMRFFRHVTIICGNAVGGGSITYANTLLVPPEHIWDEGTWADAADWKNEMP
QHYAEAERMLGVTDNKIFGPADHMLKKMGEAVGVGHTFKPTRVATFFPPEGEEGGKTYPD
PYFNGEGPDRGTCTACGGCMTGCKHNAKNTLDKNYLYFAEKNGAKVYEETKVVDVKPLNG
KADGSDGYEVTTECSSSWFNKQRRTWRVRNVIFSASSLGTQEMLFRLKQSGSLPNISDDL
GNRVRTNAESILGVRFFGKDVDMSKGVAIGSSIYIDHDTHIEATRYQSGSDAMGLMCTYM
AKGKPGWTRIFFWLWALICHPFIFLRMSNPVSFARQTLIFLVMQTADASINMRLKRNWFW
PFGKVLSSEGKKLPVYIPQANAFTEKVAKMFNGHPMTTITEILFNVPFTAHCMGGCAIAS
SPERGVVDGQNRVFNYKNLYVVDGSMLGANLGVNPSLTITALAERAMSYIPAKHTLEEQA
YTQTQGEVLEAAKVSA
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaacaattatgactatgattacctgattattggttcaggctttggtggtagt
gtttctgcttgccgtttaaccgaaaaaggctactcggttgccgtaatggaaatggggcga
cgctggaaagctgaagattttgctaaaaacaactggaatacccgccgttggatttggcgt
ccgggcatgaaacttttcggttatttcaacatgcgtttttttcgccatgtcaccattatt
tgcggtaatgccgtaggtggcggttcaattacctatgccaataccctactggttccacct
gaacatatttgggatgaaggcacgtgggcagatgccgcggactggaaaaatgaaatgcct
cagcactatgctgaagcagaacgtatgcttggcgtgactgataataaaattttcggccct
gccgaccacatgctaaagaaaatgggtgaagcagtcggtgttggccatacatttaaacct
actcgtgttgccactttctttccaccggaaggtgaagaaggtgggaagacctaccctgac
ccttattttaacggcgaaggtccagaccgtggcacttgtaccgcatgtggcggttgtatg
acgggttgtaaacacaacgcaaaaaatacattagataaaaactatttgtactttgccgaa
aaaaatggcgctaaggtttatgaagaaaccaaagtagttgacgttaaacctctcaatggt
aaagccgatggcagcgatggttatgaagtcacgactgaatgttcaagctcatggtttaac
aagcaacgtcgtacttggcgagttcgtaatgtgattttctctgcatcttctttaggcaca
caagagatgttgttccgtttaaaacagtccggttctctgccaaatatttctgatgatttg
ggtaatcgggttcgtaccaatgccgagtcgattttaggtgttcgtttttttggtaaagat
gtcgacatgagtaaaggtgttgctattggttcaagtatttacattgaccatgacactcac
attgaagcgactcgctaccaaagtggttcagatgccatgggccttatgtgtacttacatg
gctaaaggcaaaccgggttggacacgtattttcttttggttatgggcactcatttgccat
ccatttattttccttcgcatgagtaatcctgtcagttttgcacgtcaaaccttaattttc
ttggtgatgcaaaccgctgatgcctcaatcaacatgcgtttaaaacgcaattggttctgg
ccttttggcaaggtgttatcgagcgaaggtaaaaagctacctgtttatattccgcaggcc
aatgcatttaccgaaaaagttgccaaaatgtttaatggccaccccatgacgaccattacc
gaaattttgtttaacgtaccttttacagctcactgtatgggtggttgtgcaattgcttca
agtccagagcgtggtgtggtagatggacaaaatcgggtgtttaactataaaaacttatac
gttgtagatggttcaatgttaggtgcaaatttgggcgttaacccaagtctcaccattaca
gctctagcagaacgtgcaatgtcttatattccggctaaacatactttagaagaacaagct
tatactcaaactcagggtgaagttttagaagcagcaaaagtatctgcttaa

DBGET integrated database retrieval system