KEGG   Acinetobacter baumannii AYE: ABAYE2843Help
Entry
ABAYE2843         CDS       T00667                                 

Definition
ferredoxin reductase component (dioxygenase)
Orthology
K00529  
3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase subunit [EC:1.18.1.3]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Fatty acid degradation
Phenylalanine metabolism
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ABAYE2843
  Lipid metabolism
   00071 Fatty acid degradation
    ABAYE2843
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ABAYE2843
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     ABAYE2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2867343..2868554)
Genome map
AA seq 403 aa AA seqDB search
MEKIVIVGAGQAAGWAVSTLRQNGYVGEIHVVSNEDQVFYERPPLSKQVLSKEATYESLN
LFSPEQVQEFNIQWHKPEIATKVDREQKQVHLESGQILPYDKLLIATGSRARVPVNTWQF
IPNVVTLRNVHDCERLAEILKNAKNVAVIGGGWIGLEIAATARKQGKDVHIFEYGDRLCA
RSVSPEVSAFLKNMHEAQGTKIHLDSKSLHLVEAPDQKVEVVNHPQHSQLFDCVVVGAGA
EIAKELGVHAGLDVKDGIVVNCFGQTSDQDIYAAGDVAIHPGLGYCIQSWANAQNQAIAA
AKSMLGIETEYTDIPWLWSDQYHFNIQILGTYQPEKTKEAVIRQGGEDQVSYLYLDHENR
LLNMIAINDSKLIKLAKRWMQANTVLDPKLLADAEFNVMKLKP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagattgtaattgtaggggcggggcaggctgcaggttgggcagttagtacctta
cgtcaaaatggatatgtgggtgaaattcatgtggtctcaaatgaagatcaggtgttttat
gagcgtccgcctctgtctaagcaagtactttcaaaagaagcaacttatgaaagtttgaat
ttgttctctccagaacaggttcaagagttcaatattcaatggcacaaaccggaaattgca
acaaaagtcgatcgcgagcaaaagcaggttcatttagaaagtggacagattttaccctat
gacaaattgctgattgcaacaggaagtcgtgcccgtgtacccgtcaatacatggcagttc
attccaaatgttgtgactttgcgaaatgtacatgactgtgaacgtctggctgaaatttta
aagaatgcaaaaaatgtggctgtgattggcggtggctggattggtttggaaatcgctgca
actgcacgtaagcaagggaaagatgttcatatttttgaatatggggaccgcttatgtgca
agaagtgtgagtccggaagtttctgcatttttaaaaaatatgcatgaggctcaaggcaca
aaaattcatttagatagcaagagccttcacttagtggaagcaccagatcaaaaagttgaa
gtggtgaaccatcctcaacatagccagttatttgattgtgttgtagtgggtgcaggcgcc
gaaattgctaaagagttaggcgtgcatgctgggctcgatgtgaaagatggcattgtggtg
aattgttttgggcaaacctcggatcaagacatttatgccgcaggtgatgttgcgattcat
ccgggcttgggctattgcattcagtcttgggcaaatgcacaaaatcaggcgattgcagct
gcgaaatcaatgctcggaattgaaactgaatataccgatattccttggctttggtctgat
caatatcactttaatatccagattttaggaacatatcaacctgaaaaaaccaaagaagcg
gtgattcgccaaggtggtgaagatcaggtgagctatttatatctggaccatgaaaatcgc
ttgctgaatatgatagccattaatgactcgaagttaatcaagctggcaaagcgttggatg
caagccaataccgttttagatccaaaattattagcagatgctgaatttaatgtcatgaag
ttaaaaccgtaa

DBGET integrated database retrieval system