KEGG   Acinetobacter baumannii AYE: ABAYE2843Help
Entry
ABAYE2843         CDS       T00667                                 

Definition
(GenBank) putative ferredoxin reductase component (dioxygenase)
  KO
K00529  3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00071  Fatty acid degradation
aby00360  Phenylalanine metabolism
aby01120  Microbial metabolism in diverse environments
aby01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    ABAYE2843
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ABAYE2843
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     ABAYE2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Reductase_C Pyr_redox NAD_binding_8 K_oxygenase NAD_binding_7 Pyr_redox_3 HI0933_like GIDA AlaDh_PNT_C 3HCDH_N DAO FAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: CAM87671
UniProt: B0V967
Position
complement(2867343..2868554)
Genome map
AA seq 403 aa AA seqDB search
MEKIVIVGAGQAAGWAVSTLRQNGYVGEIHVVSNEDQVFYERPPLSKQVLSKEATYESLN
LFSPEQVQEFNIQWHKPEIATKVDREQKQVHLESGQILPYDKLLIATGSRARVPVNTWQF
IPNVVTLRNVHDCERLAEILKNAKNVAVIGGGWIGLEIAATARKQGKDVHIFEYGDRLCA
RSVSPEVSAFLKNMHEAQGTKIHLDSKSLHLVEAPDQKVEVVNHPQHSQLFDCVVVGAGA
EIAKELGVHAGLDVKDGIVVNCFGQTSDQDIYAAGDVAIHPGLGYCIQSWANAQNQAIAA
AKSMLGIETEYTDIPWLWSDQYHFNIQILGTYQPEKTKEAVIRQGGEDQVSYLYLDHENR
LLNMIAINDSKLIKLAKRWMQANTVLDPKLLADAEFNVMKLKP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagattgtaattgtaggggcggggcaggctgcaggttgggcagttagtacctta
cgtcaaaatggatatgtgggtgaaattcatgtggtctcaaatgaagatcaggtgttttat
gagcgtccgcctctgtctaagcaagtactttcaaaagaagcaacttatgaaagtttgaat
ttgttctctccagaacaggttcaagagttcaatattcaatggcacaaaccggaaattgca
acaaaagtcgatcgcgagcaaaagcaggttcatttagaaagtggacagattttaccctat
gacaaattgctgattgcaacaggaagtcgtgcccgtgtacccgtcaatacatggcagttc
attccaaatgttgtgactttgcgaaatgtacatgactgtgaacgtctggctgaaatttta
aagaatgcaaaaaatgtggctgtgattggcggtggctggattggtttggaaatcgctgca
actgcacgtaagcaagggaaagatgttcatatttttgaatatggggaccgcttatgtgca
agaagtgtgagtccggaagtttctgcatttttaaaaaatatgcatgaggctcaaggcaca
aaaattcatttagatagcaagagccttcacttagtggaagcaccagatcaaaaagttgaa
gtggtgaaccatcctcaacatagccagttatttgattgtgttgtagtgggtgcaggcgcc
gaaattgctaaagagttaggcgtgcatgctgggctcgatgtgaaagatggcattgtggtg
aattgttttgggcaaacctcggatcaagacatttatgccgcaggtgatgttgcgattcat
ccgggcttgggctattgcattcagtcttgggcaaatgcacaaaatcaggcgattgcagct
gcgaaatcaatgctcggaattgaaactgaatataccgatattccttggctttggtctgat
caatatcactttaatatccagattttaggaacatatcaacctgaaaaaaccaaagaagcg
gtgattcgccaaggtggtgaagatcaggtgagctatttatatctggaccatgaaaatcgc
ttgctgaatatgatagccattaatgactcgaagttaatcaagctggcaaagcgttggatg
caagccaataccgttttagatccaaaattattagcagatgctgaatttaatgtcatgaag
ttaaaaccgtaa

DBGET integrated database retrieval system