KEGG   Acinetobacter baumannii AYE: ABAYE2843Help
Entry
ABAYE2843         CDS       T00667                                 

Definition
ferredoxin reductase component (dioxygenase)
Orthology
K00529  
ferredoxin--NAD+ reductase [EC:1.18.1.3]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Fatty acid degradation
Phenylalanine metabolism
Xylene degradation
Aminobenzoate degradation
Ethylbenzene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:aby01220]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:aby00071]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:aby00360]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:aby00627]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:aby00622]
Metabolism; Xenobiotics biodegradation and metabolism; Ethylbenzene degradation [PATH:aby00642]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2867343..2868554)
Genome map
AA seq 403 aa AA seqDB search
MEKIVIVGAGQAAGWAVSTLRQNGYVGEIHVVSNEDQVFYERPPLSKQVLSKEATYESLN
LFSPEQVQEFNIQWHKPEIATKVDREQKQVHLESGQILPYDKLLIATGSRARVPVNTWQF
IPNVVTLRNVHDCERLAEILKNAKNVAVIGGGWIGLEIAATARKQGKDVHIFEYGDRLCA
RSVSPEVSAFLKNMHEAQGTKIHLDSKSLHLVEAPDQKVEVVNHPQHSQLFDCVVVGAGA
EIAKELGVHAGLDVKDGIVVNCFGQTSDQDIYAAGDVAIHPGLGYCIQSWANAQNQAIAA
AKSMLGIETEYTDIPWLWSDQYHFNIQILGTYQPEKTKEAVIRQGGEDQVSYLYLDHENR
LLNMIAINDSKLIKLAKRWMQANTVLDPKLLADAEFNVMKLKP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagattgtaattgtaggggcggggcaggctgcaggttgggcagttagtacctta
cgtcaaaatggatatgtgggtgaaattcatgtggtctcaaatgaagatcaggtgttttat
gagcgtccgcctctgtctaagcaagtactttcaaaagaagcaacttatgaaagtttgaat
ttgttctctccagaacaggttcaagagttcaatattcaatggcacaaaccggaaattgca
acaaaagtcgatcgcgagcaaaagcaggttcatttagaaagtggacagattttaccctat
gacaaattgctgattgcaacaggaagtcgtgcccgtgtacccgtcaatacatggcagttc
attccaaatgttgtgactttgcgaaatgtacatgactgtgaacgtctggctgaaatttta
aagaatgcaaaaaatgtggctgtgattggcggtggctggattggtttggaaatcgctgca
actgcacgtaagcaagggaaagatgttcatatttttgaatatggggaccgcttatgtgca
agaagtgtgagtccggaagtttctgcatttttaaaaaatatgcatgaggctcaaggcaca
aaaattcatttagatagcaagagccttcacttagtggaagcaccagatcaaaaagttgaa
gtggtgaaccatcctcaacatagccagttatttgattgtgttgtagtgggtgcaggcgcc
gaaattgctaaagagttaggcgtgcatgctgggctcgatgtgaaagatggcattgtggtg
aattgttttgggcaaacctcggatcaagacatttatgccgcaggtgatgttgcgattcat
ccgggcttgggctattgcattcagtcttgggcaaatgcacaaaatcaggcgattgcagct
gcgaaatcaatgctcggaattgaaactgaatataccgatattccttggctttggtctgat
caatatcactttaatatccagattttaggaacatatcaacctgaaaaaaccaaagaagcg
gtgattcgccaaggtggtgaagatcaggtgagctatttatatctggaccatgaaaatcgc
ttgctgaatatgatagccattaatgactcgaagttaatcaagctggcaaagcgttggatg
caagccaataccgttttagatccaaaattattagcagatgctgaatttaatgtcatgaag
ttaaaaccgtaa

DBGET integrated database retrieval system