KEGG   Acinetobacter baumannii AYE: ABAYE2909Help
Entry
ABAYE2909         CDS       T00667                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABAYE2909 (hemB)
Enzymes [BR:aby01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ABAYE2909 (hemB)
Exosome [BR:aby04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABAYE2909 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2934567..2935664
Genome map
AA seq 365 aa AA seqDB search
MGLQYSSRLTVMEYPPTYPSVIPNIEIVMTYTFNRPAFPATRMRRIRKNDQLRAMVSETQ
LTTNHLIYPVFVLPGQNQTQDIPSMPNIQRLSADLLLKKAERLLELGVSKLALFPVTPQE
DKSLTAEAAWREDGLVQTTCRLLKKELPEMVLITDGALDPYTTHGQDGIIDETGYVLNDE
TVECLIKQALSHAEAGAEVIAPSDMMDGRIGAIRQALEANGHIYTNIMAYSAKYASSFYG
PFRDAVGSASNLKGGNKYNYQMDFANRAEALHEIALDIQEGADMVIVKPGMPYLDVVREV
KDTFGIPTFIYQVSGEYAMLAGAIQNGWLSDSVILESLMCCRRAGADGIWTYFAETAAEK
LKEMN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggggctacaatacagcagtcggttgacagtaatggaatatccgccaacctatcctagt
gtaataccgaacatcgagattgttatgacttatacgttcaatcgtcctgcatttccagct
actcgcatgcgccgtatccgtaaaaatgaccagttgcgtgcgatggtcagcgaaacacag
ctcacgaccaatcacttgatttatccagtatttgtattaccaggacaaaatcaaacccaa
gatattccaagtatgccaaacattcagcgtttgtcggcagatttattactgaaaaaagct
gaaagacttctggaattgggcgtatccaaactggctcttttccctgtaacacctcaagaa
gataaaagccttaccgcagaagctgcatggcgtgaagatggtttagtacaaaccacatgt
cgtctgcttaaaaaagaattaccagaaatggtattaatcaccgatggtgcactcgaccca
tacacgactcatggtcaagacggcattattgatgaaactggctatgtgctaaacgacgag
actgtagaatgcttgattaaacaagctttaagtcacgcagaagcaggtgccgaagtaatt
gcaccaagtgacatgatggatggccgtattggcgcaattcgtcaggctttagaagccaat
ggtcacatctataccaacatcatggcctactctgcaaaatatgcgtctagcttctatggt
ccgttccgtgatgctgttggctctgcatccaacctaaaaggtggtaataaatataactac
cagatggactttgccaaccgtgccgaagcgttacatgaaatcgcgcttgatattcaagaa
ggcgccgacatggtgattgtaaaaccgggcatgccatatctggatgtggtacgtgaagtg
aaagatacctttggtattccgacattcatttatcaagtgagtggcgaatacgcaatgttg
gcgggtgcaattcaaaatggctggttatcagactcagtgattttagaatcgctcatgtgc
tgccgccgcgctggtgcagacggaatctggacttactttgcagaaaccgctgctgaaaaa
ctcaaggaaatgaactaa

DBGET integrated database retrieval system