KEGG   Acinetobacter baumannii AYE: ABAYE3176Help
Entry
ABAYE3176         CDS       T00667                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aby00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3217285..3217767)
Genome map
AA seq 160 aa AA seqDB search
MTVTTYIGLGSNLGDSRQILSEAIAKLKSLGEVKVSKLYQSPPMGPQDQPNYLNAVAQLK
TELLPLELLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNEKIQNERLTVPHVGILQRD
FVVIPLLDLDADLHINDQPLKNLELIQQPTLTVLADESWA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaccacatatattggcttaggaagtaacctaggtgactcacgccagattctg
tctgaagcgatagccaaacttaaatctcttggtgaagtgaaagtatctaaactttaccaa
agtccccctatgggtccccaagatcagccgaattatctaaatgcagtcgctcagctaaaa
accgagttacttccacttgaattacttgaccagttacagcgttttgagcaggaagctggg
cgggtgagactccgtcattggggggagcgaactttagatcttgatctactgatttatggc
aatgaaaaaatacaaaatgagcgcttaacggtgccgcatgtaggaatattacaacgagat
tttgttgtgattcctttattagatttagatgctgatctacatattaatgatcagccactt
aaaaatttagaactcatacagcagccaacgctgactgtacttgctgatgagtcttgggct
taa

DBGET integrated database retrieval system