KEGG   Acinetobacter baumannii AYE: ABAYE3272Help
Entry
ABAYE3272         CDS       T00667                                 

Gene name
nagZ
Definition
(GenBank) beta-N-acetyl-D-glucosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00520  Amino sugar and nucleotide sugar metabolism
aby01100  Metabolic pathways
aby01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ABAYE3272 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    ABAYE3272 (nagZ)
Enzymes [BR:aby01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ABAYE3272 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CAM88073
UniProt: A0A0R4J7S0
Position
3313919..3314938
Genome map
AA seq 339 aa AA seqDB search
MIGALMLDIAGTELTQEDIELLQAPQVGGMILFARNIESPQQVRALTDHMRQVRPDILIA
VDQEGGRVQRLKSGFTLLPAMGRFGELYITQPQKALELAEQCGWLMATEVLAVGIDFSFA
PVLDLNAISDVIGDRGFSKNIEDIAPLAGAFMRGMKKAGMANTGKHFPGHGSVKADSHVA
AAIDSRSYDEIYNHDMQSFIKLMPELDALMPAHVIYNQVDPNPAGFSPFWIQEVLRNRLK
FNGVLFSDDLSMQAACVAGGADARIQAALAAGCDMGLVCNDRSAACTALDGIANLELPNQ
ERLERMRGRIPQIQIGETLSLGNDWRAVKTAIEEFKNSI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgcgttgatgctggacatagccggcacagaacttactcaagaagatattgaa
ctattacaagctccgcaagtcggtggcatgattttatttgcacgaaatattgaatcacca
caacaagtccgtgctttaaccgaccatatgcgccaagttcgcccagatattttgattgct
gtcgaccaagaaggtggccgtgttcaacgtctaaaatctggctttacattattgccagcc
atgggccgttttggcgagctctatatcactcaacctcaaaaagcacttgaattagctgaa
cagtgcggctggttaatggcaactgaagttttggctgtggggatcgattttagttttgcg
ccagttttagatctgaatgcaattagcgatgtaattggtgaccgtggcttctctaaaaat
atcgaagatatcgctccacttgctggtgcatttatgcgcggtatgaaaaaagccggcatg
gcaaataccggtaagcacttccctggtcacggttcggtaaaagctgactcacatgtcgca
gctgcaatcgatagccgtagctatgacgaaatttataaccatgacatgcaaagctttatc
aagcttatgcctgagctagatgcgctcatgccagcacatgtaatttacaatcaggttgac
ccaaatccggcaggtttctcacctttctggattcaagaagtccttcgtaatcgcttgaaa
tttaatggcgtacttttctccgatgacttaagcatgcaagctgcttgtgtggctggtggt
gcagatgcgcgtattcaagcggctctggcagcaggctgtgatatggggctagtgtgtaat
gaccgtagtgcagcatgtacagcactcgatggtattgcaaacttagagctaccaaatcaa
gagcgtttagaacgtatgcgtggtcgaattccacaaatccaaattggtgaaactttatcg
cttggaaatgactggcgagctgtcaaaacagccattgaagagtttaagaattcgatttaa

DBGET integrated database retrieval system