KEGG   Acinetobacter baumannii AYE: ABAYE3296Help
Entry
ABAYE3296         CDS       T00667                                 

Definition
deoxyribonucleotide triphosphate pyrophosphatase
Orthology
K02428  
dITP/XTP pyrophosphatase [EC:3.6.1.19]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aby00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aby00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3344714..3345364
Genome map
AA seq 216 aa AA seqDB search
MVIKFGYLMSTPHWFDQGSLVLASNNKGKVAEFEKLFEQLKLPVEIIPQGRLNIPDAIED
GLSFIENAIIKARHASKISGKPAMADDSGICVPVLGGAPGIYSARYAGEHGDDAANNAKL
LNDLLPFRKNGEAIEGMFVCVLALVTHAEDPLPQIFQGIWHGEILEAPRGENGFGYDPLF
WLPELQVSSAELSKEDKNKISHRGQAMQLFRESLQK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
ttggttataaagtttggttatcttatgtctaccccacattggtttgatcagggctcttta
gtccttgcaagtaacaacaaaggtaaagtcgcagagtttgaaaaactttttgaacagctc
aagttgcctgtagaaattattcctcagggtcgtctaaatattcccgatgccattgaagac
ggcttaagctttattgaaaatgccattattaaagcacgccatgcctctaaaatttcaggt
aaacctgctatggctgatgactccggtatttgtgttccggttttagggggtgcacctggt
atttattcagcacgttatgctggagaacatggtgacgatgcagcgaataatgccaaatta
ttaaatgaccttttgccatttcgtaaaaatggtgaagcgattgaaggtatgtttgtgtgc
gtacttgctttagtgactcatgcggaagatccattgccacaaattttccaaggcatctgg
catggtgaaattttagaagcgccacgtggtgaaaatggttttggttatgacccactgttc
tggttgccagagctacaagtttctagcgctgagttgtctaaagaagacaagaataagatt
agtcatcgtgggcaagcgatgcagttatttagagagagcttgcagaagtag

DBGET integrated database retrieval system