KEGG   Acinetobacter baumannii AYE: ABAYE3470Help
Entry
ABAYE3470         CDS       T00667                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex alpha subunit [Includes: Enoyl-CoA hydratase; Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase; 3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA epimerase]
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00071  Fatty acid degradation
aby00280  Valine, leucine and isoleucine degradation
aby00281  Geraniol degradation
aby00310  Lysine degradation
aby00362  Benzoate degradation
aby00380  Tryptophan metabolism
aby00410  beta-Alanine metabolism
aby00640  Propanoate metabolism
aby00650  Butanoate metabolism
aby00903  Limonene and pinene degradation
aby00930  Caprolactam degradation
aby01040  Biosynthesis of unsaturated fatty acids
aby01100  Metabolic pathways
aby01110  Biosynthesis of secondary metabolites
aby01120  Microbial metabolism in diverse environments
aby01130  Biosynthesis of antibiotics
aby01200  Carbon metabolism
aby01212  Fatty acid metabolism
Module
aby_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABAYE3470 (fadB)
   00650 Butanoate metabolism
    ABAYE3470 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    ABAYE3470 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    ABAYE3470 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABAYE3470 (fadB)
   00310 Lysine degradation
    ABAYE3470 (fadB)
   00380 Tryptophan metabolism
    ABAYE3470 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABAYE3470 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABAYE3470 (fadB)
   00281 Geraniol degradation
    ABAYE3470 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABAYE3470 (fadB)
   00930 Caprolactam degradation
    ABAYE3470 (fadB)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ABAYE3470 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABAYE3470 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ABAYE3470 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     ABAYE3470 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: CAM88259
UniProt: B0VE45
Position
3522471..3524624
Genome map
AA seq 717 aa AA seqDB search
MIHAGNAITVQMLADGIAEFRFDLQGESVNKFNRATIEDFKAAIAAVKANNDIKGLVVTS
GKSTFIVGADITEFGQNFAQGEKAIVDWLMPVHEIFNSFEDLDLPKVAAINGMALGGGFE
MCLVCDYRVMSEAAQVGLPEIKLGIYPGFGGSVRLSRLIGIDNAVEWMAMATPKKPAAAL
KDGAVDAVVAADKLLDAATDLVKQAISGRLNWKAKRQEKLEAVKLNPLEQMMAFNTAKGA
VLAKANPAQYPAPKLLLDSLQAGASLARDEALKAEAEGFAKAAVTPQAEALIGLFINDQV
VKKASKQHEKGAHPVNQAAVLGAGIMGGGIAYQAASKGTPIIMKDIGNPQLALGMKEANN
LLTKQVERKKMKPVQMGETLARIRPTLSYEEFKEVDIVIEAVTENPKVKEIVLAETEKNV
RENTIIASNTSTISITRLAKALQRPENFVGMHFFNPVHMMPLVEVIRGEKTSEEAIATTV
VLAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKDGADFQQIDNVMSKFGWPMGPAY
LIDVVGIDTGVHGAEVMAEGFPDRMKPDYKGAIEAMYEAKRLGQKNDVGFYKYELDKKGK
KAKTVDPTAYEVIAPFVTGEKREFDNQEIIDRMMLALCNETVRCLEDNIVATASEADMAM
IMGIGFPPFRGGPCRYIDQTGVAEYVALCDKYAHLGKAYEAPQMLRDMAANNKKFYG
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgctggcaatgccattaccgtccaaatgcttgcggacggaattgcagaattc
cgctttgacttacaaggtgagtcggtcaataaattcaaccgtgcaacaattgaagatttc
aaagctgctatcgcggctgtaaaagctaataacgatattaaaggcttagttgttacctcg
ggcaaatctacattcattgttggtgcagatattaccgaatttggtcaaaactttgcacaa
ggcgaaaaagcgattgttgactggcttatgcctgttcacgaaatcttcaatagctttgaa
gatttagaccttccaaaagttgctgctattaacggcatggctttgggtggtggttttgaa
atgtgtttagtttgtgactatcgcgtgatgtcagaagctgcacaagtcggtttaccagaa
atcaaactcggtatttaccctggtttcggtggtagtgttcgtttaagccgtctcattggt
attgataatgcagttgaatggatggcaatggctactccaaagaaaccggctgctgcactt
aaagatggcgctgtagatgctgtggttgctgcggacaaattacttgacgctgctactgat
ctggttaagcaagcgatttctggtcgtttaaactggaaagcaaaacgccaagaaaaactt
gaagctgtaaaattgaacccacttgaacaaatgatggcgttcaacacagcaaaaggtgcg
gtacttgctaaagcaaatcctgctcaataccctgctccaaaattattacttgattcatta
caagctggtgcaagccttgcacgtgatgaagcgttaaaagctgaggctgaaggctttgcc
aaagcagccgtaactcctcaagctgaagcattaattggtttattcattaatgaccaagtt
gttaaaaaagcatctaagcaacatgaaaagggtgctcatcctgtaaaccaagctgctgta
cttggcgcgggtatcatgggtggtggtattgcttaccaagcggcaagcaaaggcactcca
atcatcatgaaagatattggtaacccacaacttgcattaggtatgaaagaagcaaacaac
ttgttaaccaagcaagttgaacgcaagaaaatgaaacctgtgcaaatgggtgaaacactt
gctcgcatccgtcctactttaagctacgaagagtttaaagaagtcgacatcgtgatcgaa
gcggtaactgaaaatccaaaagtaaaagaaatcgtacttgctgaaactgagaaaaatgtt
cgtgaaaacacgatcattgcttctaacacctctactatttcaattacacgtttagcaaaa
gcattacaacgtcctgaaaactttgttggtatgcacttcttcaacccagttcacatgatg
ccacttgttgaagttattcgtggtgaaaaaacttctgaagaagcaattgcaactacggtc
gtgcttgctcaaaaaatgggtaaaacaccaatcgttgtaaatgactgcccaggattcttg
gttaaccgtgtattgttcccttacttcggagcatttgaccttcttgtaaaagacggcgca
gatttccagcaaatcgacaatgtaatgtctaagttcggttggccaatgggtcctgcttat
ctgatcgatgttgtaggtatcgatacaggtgtacatggtgctgaagtgatggctgaaggt
ttccctgaccgtatgaagccagactacaaaggcgcgatcgaagcaatgtacgaagcgaag
cgtcttggtcaaaagaatgatgtaggtttctacaaatacgaactcgacaagaaaggcaag
aaagcaaaaactgttgatccaacagcgtatgaagtgattgctccattcgtaactggcgaa
aaacgcgaatttgataaccaagaaattattgaccgtatgatgcttgctctttgcaatgaa
actgttcgttgcttagaagacaacattgtagcgactgcatctgaggcagacatggcaatg
attatgggtattggtttccctccattccgtggtggtccatgccgttacatcgaccaaaca
ggtgttgctgaatatgttgcactctgcgacaaatatgcgcacttaggtaaggcttatgaa
gcgccacaaatgttgcgcgacatggctgctaacaacaaaaaattctacggttaa

DBGET integrated database retrieval system