KEGG   Acinetobacter baumannii AYE: ABAYE3541Help
Entry
ABAYE3541         CDS       T00667                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABAYE3541 (holC)
   00240 Pyrimidine metabolism
    ABAYE3541 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ABAYE3541 (holC)
   03430 Mismatch repair
    ABAYE3541 (holC)
   03440 Homologous recombination
    ABAYE3541 (holC)
Enzymes [BR:aby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ABAYE3541 (holC)
DNA replication proteins [BR:aby03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ABAYE3541 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3601625..3602032
Genome map
AA seq 135 aa AA seqDB search
MAKVSFYLFETSEERQVDSACRLCRKILLKHSQIWWYCPDVQLQQTLDEKLWSFDPISFI
AHGVDQVDAAVCISAKQPSEQGWLVFNFNNHALEQVNHFSHIIEIVENNEAAKQIGREKF
KMYRRLGIEPRTFKL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttagcttttatctgtttgaaaccagtgaagaacggcaagtcgatagtgct
tgccgtttatgtcgaaaaattttactgaagcattcacaaatctggtggtattgcccagat
gtgcagttacaacaaacacttgatgaaaaattgtggagctttgatccgatcagctttatt
gcccatggcgttgatcaggtagatgcagcagtatgtatttcggctaaacaaccttctgaa
caaggttggctggtatttaattttaacaatcatgcacttgaacaagtgaatcattttagc
cacattatagaaattgttgaaaataatgaagcagccaagcaaattggccgagaaaaattt
aaaatgtatcgtcgtctaggtatagaacctcgaacctttaaattataa

DBGET integrated database retrieval system