KEGG   Acinetobacter baumannii AYE: ABAYE3614Help
Entry
ABAYE3614         CDS       T00667                                 

Gene name
dfrA10
Definition
dihydrofolate reductase type A10 (dihydrofolate reductase type X) (DHFRX) (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aby  Acinetobacter baumannii AYE
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABAYE3614 (dfrA10)
   00670 One carbon pool by folate
    ABAYE3614 (dfrA10)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ABAYE3614 (dfrA10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3651834..3652397)
Genome map
AA seq 187 aa AA seqDB search
MNISLIFANELITRAFGNQGKLPWQFIKEDMQFFQKTTENSVVVMGLNTWRSLPKMKKLG
RDFIVISSTITEHEVLNNNIQIFKSFESFLEAFRDTTKPINVIGGVGLLSEAIEHASTVY
MSSIHMVKPVHADVYVPVELMNKLYSDFKYPENILWVGDPIDSVYSLSIDKFVRPASLVG
VPNDINT
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatcacttatctttgccaatgaattaattaccagagcattcggtaatcaaggc
aaattaccttggcaattcattaaagaagatatgcagttcttccagaagactacagaaaat
tctgtagtcgttatgggattaaatacatggagatctctacctaagatgaagaagcttggt
agagacttcattgtcatatcttcaactatcacagagcacgaagtgctcaacaataatatc
caaatattcaaatcatttgagagcttcttagaagcattcagagacacaaccaaaccaatc
aatgtcattggtggtgttggtttattatctgaagcgatagaacatgctagcactgtttac
atgagttctattcatatggttaaacctgttcatgctgatgtgtatgtaccggtagaacta
atgaataaactctatagtgatttcaaatatccagaaaatattctatgggtaggtgatcca
atagattctgtgtatagcttgtctattgataagtttgttagaccagcttcgctggttggg
gtgccaaatgatattaatacgtga

DBGET integrated database retrieval system