KEGG   Acinetobacter baumannii AYE: ABAYE3644Help
Entry
ABAYE3644         CDS       T00667                                 

Gene name
dhfrI
Definition
dihydrofolate reductase type 1 (dihydrofolate reductase type I) (trimethoprim resistance protein) (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aby  Acinetobacter baumannii AYE
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aby00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aby00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3676916..3677389)
Genome map
AA seq 157 aa AA seqDB search
MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactatcactaatggtagctatatcgaagaatggagttatcgggaatggccctgat
attccatggagtgccaaaggtgaacagctcctgtttaaagctattacctataaccaatgg
ctgttggttggacgcaagacttttgaatcaatgggagcattacccaaccgaaagtatgcg
gtcgtaacacgttcaagttttacatctgacaatgagaacgtattgatctttccatcaatt
aaagatgctttaaccaacctaaagaaaataacggatcatgtcattgtttcaggtggtggg
gagatatacaaaagcctgatcgatcaagtagatacactacatatatctacaatagacatc
gagccggaaggtgatgtttactttcctgaaatccccagcaattttaggccagtttttacc
caagacttcgcctctaacataaattatagttaccaaatctggcaaaagggttaa

DBGET integrated database retrieval system