KEGG   Acinetobacter baumannii AYE: ABAYE3644Help
Entry
ABAYE3644         CDS       T00667                                 

Gene name
dhfrI
Definition
dihydrofolate reductase type 1 (dihydrofolate reductase type I) (trimethoprim resistance protein) (EC:1.5.1.3)
Orthology
K18589  
dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3]
Organism
aby  Acinetobacter baumannii AYE
Pathway
One carbon pool by folate
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABAYE3644 (dhfrI)
   00670 One carbon pool by folate
    ABAYE3644 (dhfrI)
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ABAYE3644 (dhfrI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3676916..3677389)
Genome map
AA seq 157 aa AA seqDB search
MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYA
VVTRSSFTSDNENVLIFPSIKDALTNLKKITDHVIVSGGGEIYKSLIDQVDTLHISTIDI
EPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactatcactaatggtagctatatcgaagaatggagttatcgggaatggccctgat
attccatggagtgccaaaggtgaacagctcctgtttaaagctattacctataaccaatgg
ctgttggttggacgcaagacttttgaatcaatgggagcattacccaaccgaaagtatgcg
gtcgtaacacgttcaagttttacatctgacaatgagaacgtattgatctttccatcaatt
aaagatgctttaaccaacctaaagaaaataacggatcatgtcattgtttcaggtggtggg
gagatatacaaaagcctgatcgatcaagtagatacactacatatatctacaatagacatc
gagccggaaggtgatgtttactttcctgaaatccccagcaattttaggccagtttttacc
caagacttcgcctctaacataaattatagttaccaaatctggcaaaagggttaa

DBGET integrated database retrieval system