KEGG   Acinetobacter baumannii AYE: ABAYE3713Help
Entry
ABAYE3713         CDS       T00667                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    ABAYE3713
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABAYE3713
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ABAYE3713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3746661..3747206
Genome map
AA seq 181 aa AA seqDB search
MTQSVYHIPVKAISGETVDLDQYKGKVLLIVNTASKCGLTPQYEGLEKLYQAKKDQGLEI
LGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGEDKHPLYQVLTTAQPERIG
EGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVVARFAPNLTADDEQIVKAVEEELA
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatctgtatatcatattccagtaaaagctatttcaggcgaaacggttgacctt
gaccaatataaagggaaagttttattaatcgtaaacacagcgtctaaatgtggtttaact
ccacaatacgaaggtttagaaaagctgtatcaagcaaagaaagatcaaggtcttgaaatc
ttaggcttccctgcaaacaactttaaagaacaagagcctggttcggatgaagaaattcaa
cagttctgctcattaaactacgatgttcatttcccacttttctctaaaatctctgtagct
ggcgaagataaacatccactttatcaagtgctaacaacagctcaaccagaacgtattgga
gaaggtcctttccgtgaacgcttagaaggtttaggtattcctactaaccctgcccctgaa
gtgttatggaacttcgagaaattcctagtaaataaaaacggtgaagttgttgcgcgtttt
gctcctaacttaacagcagacgatgaacaaattgtaaaagcagttgaagaagaattagct
aaataa

DBGET integrated database retrieval system