KEGG   Acinetobacter baumannii AYE: ABAYE3803Help
Entry
ABAYE3803         CDS       T00667                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00040  Pentose and glucuronate interconversions
aby00052  Galactose metabolism
aby00500  Starch and sucrose metabolism
aby00520  Amino sugar and nucleotide sugar metabolism
aby01100  Metabolic pathways
aby01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABAYE3803 (galU)
   00052 Galactose metabolism
    ABAYE3803 (galU)
   00500 Starch and sucrose metabolism
    ABAYE3803 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ABAYE3803 (galU)
Enzymes [BR:aby01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ABAYE3803 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: CAM88564
UniProt: A0A0R4J7N8
Position
complement(3842808..3843683)
Genome map
AA seq 291 aa AA seqDB search
MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVEAGIEQIILVTHSSKA
SIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSIISVRQPQPLGLGHAVLCAKSIV
GEDDFAVLLPDVLVKDSSGQNDLSRMISRYNSSQAAQIMVEAVPDHLVDQYGIVDVKLSP
NEGESIAMQGIVEKPPVGAAPSNLSVVGRYVLPAKIMQLLENTPKGAGNEIQLTDAIAML
QDTDTVEAYRMQGQTFDCGSKLGYLKAVLHYGLEHPKLGMEFKQLIQELKL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaaaaagcagttttacctgtagccggtttaggcacacgttttttaccagcaagt
aagtcaattcctaaggaaatggtcacagtggttgaccgtcctgcaattgaatatgtagta
cgcgaagctgtagaggctggaattgagcaaattattttagtcactcattcatctaaagcc
tcgatcgaaaattattttgatcgtaactttgagttggaaacgactctagaacaaaagaaa
aaatttgacttacttgcagaaattactcaaattgtgcctgaacatgtaagtataatcagt
gttaggcagcctcaacctttaggtttaggacacgctgttttatgtgcaaagagtatcgtt
ggcgaagatgattttgcagtgctcttaccagatgtgctagtgaaagatagctctggacaa
aatgatctatctcgtatgatttctcgctacaactcaagccaagctgctcaaatcatggtt
gaggcagtgccagatcatttagtagatcaatatggcattgttgatgtaaaacttagccca
aatgagggcgaaagtattgctatgcagggtattgttgaaaaaccccctgtaggtgctgca
ccatcaaacttatctgtggttggccgctatgtgttacctgccaagattatgcaattactt
gagaacacgccgaaaggtgcaggtaatgaaattcagttaactgatgcaattgcaatgctt
caagatacagatacagttgaagcttaccgtatgcaaggccaaacgtttgactgtggtagt
aagcttggttatttaaaagctgtattacattatggcttagaacatccaaaattaggaatg
gaatttaaacagctgattcaagaacttaaattataa

DBGET integrated database retrieval system