KEGG   Acinetobacter baumannii AYE: p2ABAYE0004Help
Entry
p2ABAYE0004       CDS       T00667                                 

Definition
putative alcohol dehydrogenase, zinc-containing (EC:1.1.1.-)
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
aby  Acinetobacter baumannii AYE
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    p2ABAYE0004
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     p2ABAYE0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p2ABAYE:complement(2822..3904)
Genome map
AA seq 360 aa AA seqDB search
MENIMKAMVYYGDHDIRFEERKKPELIDPTDAIIKMTKTTICGTDLGIYKGKNPEIEQKE
QEKNGSFNGRILGHEGIGIVEQIGSSVKNIKVGDKVIVSCVSRCGTCENCAKQLYSHCRN
DGGWIMGYMIDGTQAEYVRTPFADTSLYVLPEGLNEDVAVLLSDALPTAHEIGVQNGDIK
PGDTVAIVGAGPVGMSALLTAQFYSPSQIIMIDMDENRLAMAKELGATDTINSGTEDAIA
RVMELTNQRGVDCAIEAVGIEPTWDICQNIVKEGGHLANVGVHGKSVNFSLEKLWIKNLT
ITTGLVNANTTGMLLKSCCSGKLPMEKLATHHFKFNEIEKAYDVFINAAKEKAMKVIIDF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatataatgaaagcaatggtttattatggtgatcatgatattagattcgaggaa
cgcaaaaaaccagaactaattgatccgacagatgccattattaaaatgacaaaaacgaca
atttgtggaacggatcttggtatttataaaggtaaaaatcctgaaattgaacaaaaagaa
caagaaaaaaatggttcattcaatggtcgtattttaggtcatgaaggtattggtattgtt
gaacaaattggttcatcagtaaaaaatatcaaagttggcgataaagtaattgtttcatgc
gtaagtcgttgtggtacatgtgaaaactgtgcaaaacagttatattctcattgtcgcaat
gatggtggttggatcatgggatacatgatcgatggaactcaagctgagtatgtacgtact
ccttttgctgatacttcattatatgtgctacctgaaggcttaaatgaagatgtagctgtt
ttactttctgatgctctacctacagctcatgaaattggtgttcaaaatggggatattaag
cctggtgatacagtggctattgttggtgccggccctgttggtatgagtgcactattaaca
gctcaattttactctccaagtcaaatcattatgattgatatggatgaaaaccgcttagct
atggcaaaagagttaggagcaacggatacaattaattcgggaacagaagatgctattgca
cgcgtaatggagttaactaatcaacgtggtgttgattgtgctattgaagctgtaggaatt
gagcctacttgggatatttgtcaaaacattgtcaaagaaggcggacatttagctaacgtt
ggtgtgcatggtaagtctgtgaacttttctcttgaaaaattatggattaaaaatttaaca
atcactactggcttagtgaatgcaaatactacaggaatgctattaaaatcttgttgttct
ggaaaacttccaatggaaaagttagcaacgcatcattttaaatttaatgaaattgaaaaa
gcatatgatgtattcattaatgcagcaaaagaaaaagcaatgaaagtaattattgatttt
taa

DBGET integrated database retrieval system