KEGG   Acinetobacter baumannii AYE: p2ABAYE0004Help
Entry
p2ABAYE0004       CDS       T00667                                 

Definition
(GenBank) putative alcohol dehydrogenase, zinc-containing
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
aby  Acinetobacter baumannii AYE
Pathway
aby00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:aby00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    p2ABAYE0004
Enzymes [BR:aby01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     p2ABAYE0004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C TrkA_N ACP_syn_III_C Pyr_redox_2 ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: CAM84618
UniProt: B0V3X3
Position
p2ABAYE:complement(2822..3904)
Genome map
AA seq 360 aa AA seqDB search
MENIMKAMVYYGDHDIRFEERKKPELIDPTDAIIKMTKTTICGTDLGIYKGKNPEIEQKE
QEKNGSFNGRILGHEGIGIVEQIGSSVKNIKVGDKVIVSCVSRCGTCENCAKQLYSHCRN
DGGWIMGYMIDGTQAEYVRTPFADTSLYVLPEGLNEDVAVLLSDALPTAHEIGVQNGDIK
PGDTVAIVGAGPVGMSALLTAQFYSPSQIIMIDMDENRLAMAKELGATDTINSGTEDAIA
RVMELTNQRGVDCAIEAVGIEPTWDICQNIVKEGGHLANVGVHGKSVNFSLEKLWIKNLT
ITTGLVNANTTGMLLKSCCSGKLPMEKLATHHFKFNEIEKAYDVFINAAKEKAMKVIIDF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatataatgaaagcaatggtttattatggtgatcatgatattagattcgaggaa
cgcaaaaaaccagaactaattgatccgacagatgccattattaaaatgacaaaaacgaca
atttgtggaacggatcttggtatttataaaggtaaaaatcctgaaattgaacaaaaagaa
caagaaaaaaatggttcattcaatggtcgtattttaggtcatgaaggtattggtattgtt
gaacaaattggttcatcagtaaaaaatatcaaagttggcgataaagtaattgtttcatgc
gtaagtcgttgtggtacatgtgaaaactgtgcaaaacagttatattctcattgtcgcaat
gatggtggttggatcatgggatacatgatcgatggaactcaagctgagtatgtacgtact
ccttttgctgatacttcattatatgtgctacctgaaggcttaaatgaagatgtagctgtt
ttactttctgatgctctacctacagctcatgaaattggtgttcaaaatggggatattaag
cctggtgatacagtggctattgttggtgccggccctgttggtatgagtgcactattaaca
gctcaattttactctccaagtcaaatcattatgattgatatggatgaaaaccgcttagct
atggcaaaagagttaggagcaacggatacaattaattcgggaacagaagatgctattgca
cgcgtaatggagttaactaatcaacgtggtgttgattgtgctattgaagctgtaggaatt
gagcctacttgggatatttgtcaaaacattgtcaaagaaggcggacatttagctaacgtt
ggtgtgcatggtaagtctgtgaacttttctcttgaaaaattatggattaaaaatttaaca
atcactactggcttagtgaatgcaaatactacaggaatgctattaaaatcttgttgttct
ggaaaacttccaatggaaaagttagcaacgcatcattttaaatttaatgaaattgaaaaa
gcatatgatgtattcattaatgcagcaaaagaaaaagcaatgaaagtaattattgatttt
taa

DBGET integrated database retrieval system