KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00278Help
Entry
ABZJ_00278        CDS       T01820                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:abz00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:abz00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:abz03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:abz03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:abz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(302181..302558)
Genome map
AA seq 125 aa AA seqDB search
MAKVSFYLFETSEERQVDSACRLCRKILLKHSQIWWYCPDVQLQQTLDEKLWSFDPTSFI
AHGVDQVDAAVCISAKQPSEQGWLVFNFNNHALEQVNHFSHIIEIVENNEAAKQIGRENL
KCIVV
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttagcttttatctgtttgaaaccagtgaagaacggcaagtcgatagtgct
tgccgtttatgccgaaaaattttactgaagcattcacaaatctggtggtattgcccagat
gtgcagttacaacaaacacttgatgaaaaattgtggagctttgatccgaccagctttatt
gcccatggcgttgatcaggtagatgcggcagtatgtatttcggctaaacaaccttctgaa
caaggttggctggtatttaattttaacaatcatgcacttgaacaagtgaatcattttagc
cacattatagaaattgttgaaaataatgaagcagccaagcaaattggccgagaaaattta
aaatgtatcgtcgtttag

DBGET integrated database retrieval system