KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00290Help
Entry
ABZJ_00290        CDS       T01820                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(316957..317772)
Genome map
AA seq 271 aa AA seqDB search
MSFTRSQIFLACALASSLLFSACSKENKPQKEDALTATAPATGEASTIIERNAKQRLIET
LQKQFKNANINVKILDIKPTEVPNLYWVNLEGMTSVYTTSDGKYLIQGDVIRLGDKELHN
IGDSLQASENKKHLAALKNEDLIVYPAKGGKAKHVIYVFTDASCPYCHKLHEHLAEINEK
GIEVRYIAWPRGEQFMPTMEAVWCSADRKAAFDQAVQGISIPPAQCKNPVREQYQLGLNM
GVNGTPAIYNVDGEYLGGYLTPDELIKRLDK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttacccgatctcaaatttttcttgcctgtgctttggcttctagcctgttgttc
agtgcttgttctaaagaaaacaaaccacaaaaagaagatgcgctcacagcgaccgcacct
gctacaggggaagcttcaaccattattgaacgcaatgctaaacagcgtttaattgaaact
ttgcaaaaacaatttaagaatgcaaacatcaacgtcaaaattttagatattaagcctacc
gaagtgcctaatttatattgggttaaccttgaaggaatgacgtcggtttatacaacaagt
gatggtaaatacctgattcaaggtgatgtcatccgtttaggtgataaagaacttcataat
atcggcgatagccttcaagcctcagaaaacaaaaagcatcttgctgctttaaaaaatgaa
gacttaattgtttatccagctaaaggcggtaaagctaaacatgtgatttatgtgtttacc
gatgcaagctgtccttactgccataaattacatgagcatttagctgagattaatgagaaa
ggcattgaggttcgttacattgcatggccacgcggcgaacagtttatgccaactatggaa
gcggtttggtgtagtgcagaccgtaaagctgcatttgaccaagctgtacagggcattagt
attccacctgctcaatgtaaaaaccctgttcgcgaacaataccaacttggtctaaacatg
ggcgtaaatggtacaccagctatttataatgttgatggtgagtacttgggtggctactta
acaccggatgaattgattaaacgattggataaataa

DBGET integrated database retrieval system