KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00374Help
Entry
ABZJ_00374        CDS       T01820                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABZJ_00374
   01230 Biosynthesis of amino acids
    ABZJ_00374
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABZJ_00374
   00051 Fructose and mannose metabolism
    ABZJ_00374
   00562 Inositol phosphate metabolism
    ABZJ_00374
Enzymes [BR:abz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABZJ_00374
Exosome [BR:abz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABZJ_00374
  Exosomal proteins of bladder cancer cells
   ABZJ_00374
  Exosomal proteins of melanoma cells
   ABZJ_00374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406526..407329
Genome map
AA seq 267 aa AA seqDB search
MSSMSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENCHVGVAPVSIALTT
VQAQLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNV
EILKAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICDIAPVVTAEQWQNQVVIA
YEPIWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSNIAILYGGSVKAENAVELAACPD
INGALVGGASLNAASFYQIVQAFAQSK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtatgtcgggttcgacgattacgccttgggtagttggtaactggaaaatgaat
ccaatgcgtgccaacgccaaccaacttatagaagaatttaaacaattattgcaacaaaac
caaattgcagatgaaaactgccatgtgggcgttgcccctgtttctattgctcttacaacg
gtacaagcgcaattacaggatgctgcaagaacggtatatacggttgcacaggatgtatca
cgtgttgctggtacaggtgcttatactggtgaagtcagtgcagaactattaaaagatagc
caaattaatttcgtacttgtaggacactctgaacgtcgtgatatttttggtgacaacgtt
gaaattttgaaggcaaaactccaaaatgcattaaatgcgggtatgactgtcatttattgt
gtgggcgaaagccttgaacaacgtgagcaaggtcaggccgagcaagttgttctacagcaa
atttgtgatattgcacctgtagttactgcagaacaatggcaaaaccaagtggttattgcc
tatgaacctatttgggcaattggtacaggtaaaacagcttctccgcaagatgcgcaagcg
atgcacgctaaaattcgtgaaggcttatgccaacttacaccagcaggctcaaatattgct
attttatatggcggtagtgtaaaagctgaaaatgctgttgagttagctgcatgtccagat
atcaatggtgcgttggtgggtggtgcttcattaaatgcagcatctttttatcaaattgta
caagccttcgcgcaaagcaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system