KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00374Help
Entry
ABZJ_00374        CDS       T01820                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABZJ_00374
   01230 Biosynthesis of amino acids
    ABZJ_00374
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABZJ_00374
   00051 Fructose and mannose metabolism
    ABZJ_00374
   00562 Inositol phosphate metabolism
    ABZJ_00374
Enzymes [BR:abz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABZJ_00374
Exosome [BR:abz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABZJ_00374
  Exosomal proteins of bladder cancer cells
   ABZJ_00374
  Exosomal proteins of melanoma cells
   ABZJ_00374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406526..407329
Genome map
AA seq 267 aa AA seqDB search
MSSMSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENCHVGVAPVSIALTT
VQAQLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLVGHSERRDIFGDNV
EILKAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICDIAPVVTAEQWQNQVVIA
YEPIWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSNIAILYGGSVKAENAVELAACPD
INGALVGGASLNAASFYQIVQAFAQSK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtatgtcgggttcgacgattacgccttgggtagttggtaactggaaaatgaat
ccaatgcgtgccaacgccaaccaacttatagaagaatttaaacaattattgcaacaaaac
caaattgcagatgaaaactgccatgtgggcgttgcccctgtttctattgctcttacaacg
gtacaagcgcaattacaggatgctgcaagaacggtatatacggttgcacaggatgtatca
cgtgttgctggtacaggtgcttatactggtgaagtcagtgcagaactattaaaagatagc
caaattaatttcgtacttgtaggacactctgaacgtcgtgatatttttggtgacaacgtt
gaaattttgaaggcaaaactccaaaatgcattaaatgcgggtatgactgtcatttattgt
gtgggcgaaagccttgaacaacgtgagcaaggtcaggccgagcaagttgttctacagcaa
atttgtgatattgcacctgtagttactgcagaacaatggcaaaaccaagtggttattgcc
tatgaacctatttgggcaattggtacaggtaaaacagcttctccgcaagatgcgcaagcg
atgcacgctaaaattcgtgaaggcttatgccaacttacaccagcaggctcaaatattgct
attttatatggcggtagtgtaaaagctgaaaatgctgttgagttagctgcatgtccagat
atcaatggtgcgttggtgggtggtgcttcattaaatgcagcatctttttatcaaattgta
caagccttcgcgcaaagcaaataa

DBGET integrated database retrieval system