KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00397Help
Entry
ABZJ_00397        CDS       T01820                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:abz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABZJ_00397
Enzymes [BR:abz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ABZJ_00397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
439075..440838
Genome map
AA seq 587 aa AA seqDB search
MDKCVDNLNSPEQSDLSWLTTWSTFLNQAPFTAQTQAPEAAYFLQQLIEASLQGDSCIEI
SPEQIETLGQLVISAEQAKSQVAPCVHDEQGLALYRYWNLEQRLAEQIRRLKQQPIQPVS
CEEHLDLLTDPHQQAALQMVTRQSLSIITGGPGTGKTYTLARIIAVLSQAIPHIRVAMAA
PTGKAAQRMQEALQNSFNDPKLLESGLISAELRNQSTQTIHRLLGMGHSQTPRFNQKQPL
PYDVIVVDEASMLDLNLATLLFEAVPESCRIILLGDANQLASVDVGAVLADLQQIEALSE
NRVHLQTSRRFAEGALIGQVARFIQMQTSQINHEQILQKFEIDIVQVSELRSIPLETDMP
DVVQLEYLPEESPIALETYYQKLMVDFQGYVQSLKAYIQDDRSLEHIENIVRSFDDYRIL
TAVRHGPFGLQQLNQYAERWLQQQLGIVTLGGWYVGRPVMMTYNDYQLGISNGDIGLCFE
HRTQPQQFEVYFPSLNKWVAANRLPKSIQSAFALTIHKSQGSEFTHTAVVLDQAAKNLLS
QELIYTAITRAKKVVSLLVDPEALLQSFTVRTTRKSGLVEKVNRLVR
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtggataagtgtgtggacaatctaaatagccctgaacaaagcgatttaagctggttaacg
acttggagtacctttctaaatcaagccccgtttactgcacagacacaagctccagaggca
gcttattttttgcagcagctgattgaagcgagcttgcagggtgacagttgtattgagatt
agcccagagcaaatagaaacacttggccaactggtgatatctgctgaacaagcaaagtct
caagttgccccttgtgtccacgacgagcaggggttggcattataccgatattggaaccta
gagcaacgtctagctgagcaaattcgccgattaaagcaacaaccaattcaacctgtttca
tgtgaagagcatttagacttattaacagatcctcatcagcaagctgctttgcaaatggtg
actcggcagagcttaagtattattacaggtgggccgggtacaggtaagacctatacgctc
gctcgtattattgctgtgcttagtcaggcaattccacatattcgtgtagcgatggctgct
ccgacgggtaaagctgcacagcgtatgcaagaagccttacaaaactcctttaatgaccca
aaactgcttgagtcggggttaataagtgctgagctaagaaaccaaagtacccaaactatc
catcgattattaggtatggggcatagtcaaactccacggtttaatcaaaaacagcctttg
ccttatgacgttattgtggtggatgaagcctctatgctggacttaaatctggcaacgtta
ttatttgaagcggttcctgagtcttgtcgaattattttattaggtgatgccaaccagctt
gcttccgtagacgtcggagctgtacttgcagatttacagcaaatcgaggctttgtctgaa
aaccgtgttcaccttcaaaccagccgtcgttttgcggaaggggctttgattggtcaggtt
gcccgatttattcaaatgcaaaccagtcaaatcaaccatgagcaaattttacaaaaattt
gaaatcgatattgttcaggtttcagagttacgttcaatacctttagaaaccgacatgccc
gatgtggttcagcttgaatatttacccgaagagtcacctatagcgctagaaacttactac
caaaaattgatggtggattttcaaggctatgtgcaaagcttaaaagcttatatacaagat
gatcgttcacttgaacatattgaaaatatcgttaggtcattcgatgactaccgtatttta
actgccgtacgtcatggaccatttggtttacagcaacttaatcaatatgctgaacgctgg
ttacaacaacagctaggtattgtgactttaggaggatggtatgttggccgtccggttatg
atgacctataacgattaccagctcggtatttcaaatggtgacattggtttatgttttgaa
catagaacccagccgcaacagtttgaagtgtattttccaagtttaaataagtgggttgct
gcaaatcggctacctaaaagtattcaaagtgcatttgccttaacaattcacaaatcacaa
ggttctgaatttacccatacagctgttgttcttgatcaggctgccaagaatttgttaagc
caagagttgatctacactgcgattacacgagccaaaaaagtagtgagtttattggtcgat
ccagaggcgttacttcaatcttttacagttcgcacgacaagaaaaagcggtttagttgaa
aaagttaatcggttagttcgttaa

DBGET integrated database retrieval system