KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00622Help
Entry
ABZJ_00622        CDS       T01820                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABZJ_00622
Enzymes [BR:abz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     ABZJ_00622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675839..676321
Genome map
AA seq 160 aa AA seqDB search
MTVTTYIGLGSNLGDSRQILSEAIAKLKSLGEVKVSKLYQSPPMGPQDQPNYLNAVAQLK
TELLPLDLLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNEKIQNERLTVPHVGILQRD
FVVIPLLDLDADLHINDQPLKNLELIQQPTLTVLADESWA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaccacatatattggcttaggaagtaacctaggtgactcacgccagattctg
tctgaagcgatagccaaacttaaatctcttggtgaagtgaaagtatctaaactttaccaa
agtccccctatgggtccccaagatcagccgaattatctaaatgcagtcgctcagctaaaa
accgagttacttccgcttgacttacttgaccagttacagcgttttgagcaggaagctggg
cgggtaagactccgtcattggggggagcgaactttagatcttgatctactgatttatggc
aatgaaaaaatacaaaatgagcgcttaacggtgccgcatgtaggaatattacaacgagat
tttgttgtgattcctttattagatttagatgctgatctacatattaatgatcagccactt
aaaaatttagaactcatacaacagccaacgctgactgtacttgctgatgagtcttgggct
taa

DBGET integrated database retrieval system