KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_00878Help
Entry
ABZJ_00878        CDS       T01820                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00010  Glycolysis / Gluconeogenesis
abz00030  Pentose phosphate pathway
abz00051  Fructose and mannose metabolism
abz00052  Galactose metabolism
abz00230  Purine metabolism
abz00500  Starch and sucrose metabolism
abz00520  Amino sugar and nucleotide sugar metabolism
abz00521  Streptomycin biosynthesis
abz01100  Metabolic pathways
abz01110  Biosynthesis of secondary metabolites
abz01120  Microbial metabolism in diverse environments
abz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABZJ_00878
   00030 Pentose phosphate pathway
    ABZJ_00878
   00051 Fructose and mannose metabolism
    ABZJ_00878
   00052 Galactose metabolism
    ABZJ_00878
   00500 Starch and sucrose metabolism
    ABZJ_00878
   00520 Amino sugar and nucleotide sugar metabolism
    ABZJ_00878
  Nucleotide metabolism
   00230 Purine metabolism
    ABZJ_00878
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABZJ_00878
Enzymes [BR:abz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ABZJ_00878
    5.4.2.8  phosphomannomutase
     ABZJ_00878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AEP05338
UniProt: G2JCT5
Position
962140..963558
Genome map
AA seq 472 aa AA seqDB search
MNVRHSFPKNIFRAYDIRGKLSYLTTDVVRSIAYGLAQQYKQAEQTQLIIGYDARLTSPA
YAHLIEEILVEQGLNVTNIGCCSTPMMYYIAREFGGNGIMVTASHNPKSDNGIKWILRGE
PPSPEMIQQVGEFAQTYVPTHTISLLELSTPQFNSEFCKKYQQAIFNDIQLKRPLKVVLD
GLHGSAGHCSKLVLEKMGCEVIALRTTPNGEFPDHAPDPSHAAHLKELRKTIIEQGADIG
IALDGDGDRVVLLDEKANILTADRLLSLFAQMCLEQQPDKEIVFDVKCSLMVQRTVERLG
GKPKMIRTGSSFLRAYLSQSNGNAIFGGEYAGHYVFNDGRGFGYDDGLYAALRVMEYFTE
SSAATISDLFSNYPERCCTEDTYIGTHQSDPKHVLQDIEILSHRLGARISKIDGVRLDFD
DGFGIIRASNTGEYFTVRFDADNPLRLKEIQQKFIDMLQERYPQIAQELSEA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaagacactcatttccaaaaaatattttccgtgcttacgatattagaggcaaa
ctttcttatttaactacggacgtcgtccgttcaattgcctatggattggcacaacaatat
aaacaagcagaacaaactcaactgattattggttatgatgcgcgcctaacgagtccggct
tatgcgcatttaatcgaagagatattagtagagcagggtttaaatgttacaaatattggt
tgttgctcaaccccgatgatgtactacattgcacgggagtttggtggtaatggcataatg
gtaacagctagccataaccctaaatcagataatggtattaaatggattttaagaggtgaa
cctccatctcctgaaatgatccagcaagtaggtgaatttgcgcaaacttatgtacctact
catacaatttcattattagaattatcaactcctcaatttaattcagaattttgtaaaaaa
taccaacaagcaatctttaacgatattcaactcaagcgccctttaaaagttgtattagat
ggcctacatggatcggcagggcattgctcaaaactcgtacttgaaaaaatgggttgtgaa
gtcattgctttacgtacgactccaaatggtgagttccctgatcatgcaccagacccttca
catgctgcgcatttaaaagaactacgtaaaacgattattgaacagggggcagatattggt
attgcccttgatggtgatggcgaccgtgtcgtattgcttgatgaaaaagccaatatactt
actgctgaccgtttattgtcactatttgcacaaatgtgtctggagcagcaaccagacaaa
gaaattgtatttgatgtgaaatgctcgctcatggttcaaagaaccgtagagcgacttggt
ggtaaacccaaaatgattcgcacgggaagtagcttcctgcgcgcgtatttatcccaatca
aatggtaacgctatttttgggggcgaatacgcgggtcattatgtatttaatgatgggcgt
ggttttgggtatgatgatggtttgtacgctgcattacgtgtaatggaatatttcaccgag
tcgagtgcggcaacaatttctgatttattttctaattatcctgaaagatgctgtaccgaa
gatacttatattggcacccatcagtccgaccctaaacatgtactacaagatattgaaatt
ttaagccatcgtttgggtgctcgaattagtaaaattgatggcgtacgtcttgattttgat
gatggttttggcattattcgagcatcaaatacaggtgagtattttaccgtaagatttgac
gctgataatcctttacgtttaaaggaaatccagcaaaaatttattgatatgttgcaagag
cgttatccgcaaattgcacaagaactttctgaggcctaa

DBGET integrated database retrieval system