KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01089Help
Entry
ABZJ_01089        CDS       T01820                                 

Definition
multifunctional protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    ABZJ_01089
Enzymes [BR:abz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ABZJ_01089
   3.1.2  Thioester hydrolases
    3.1.2.-  
     ABZJ_01089
Lipid biosynthesis proteins [BR:abz01004]
 Fatty acid synthase
  Component type
   ABZJ_01089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1167523..1168146)
Genome map
AA seq 207 aa AA seqDB search
MYKSYLFGSKSLLLISLSMLPMFVSAKTILILGDSISAGYGIDPKQGWVQLLQKRLDQQY
PKQHKVVNASVSGETTSGALARLPKLLQTYKPEVVVIELGGNDGLRGQPPQMIQKNLSQL
IQLSQKQKAKVILFGMKIPPNYGTAYSKAFENSYKTVSQKYQVKLLPFFLDGVAGQKQLM
QNDLIHPNTQAQSKLLNLAYPYIKGAL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtataaatcttatttgtttggttctaaaagtctcttgctcatctcattgagcatgttg
cccatgttcgtctcggcaaaaactattttaattttaggagatagtattagtgccggttat
ggaatagaccctaaacaaggttgggtacaattactacaaaaacgtttagaccaacagtat
cccaaacaacataaagtggtcaatgcaagtgtgagtggggaaaccactagtggcgctttg
gcacgattaccaaaacttttacaaacgtataaacccgaggtagttgttattgaattaggc
gggaatgatggcttacgtggtcaaccaccacaaatgattcaaaaaaatctgtctcagctc
attcaattaagccagaagcaaaaagccaaggttattctttttggtatgaagattccgccc
aattatggcacggcttatagcaaagcattcgaaaatagctacaaaactgtaagtcaaaaa
tatcaggtgaaattgctaccgttttttcttgatggcgtcgctgggcaaaagcaactaatg
caaaatgacttgattcatccaaatacccaagcacaatcaaaattactgaatttagcttac
ccatacataaaaggtgccctatag

DBGET integrated database retrieval system