KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01291Help
Entry
ABZJ_01291        CDS       T01820                                 

Definition
dihydropteroate synthetase type 1
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:abz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346019..1346858
Genome map
AA seq 279 aa AA seqDB search
MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPAD
EIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADC
RLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFL
SPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAELHAIGN
GADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGLDHA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggtgacggtgttcggcattctgaatctcaccgaggactccttcttcgatgagagccgg
cggctagaccccgccggcgctgtcaccgcggcgatcgaaatgctgcgagtcggatcagac
gtcgtggatgtcggaccggccgccagccatccggacgcgaggcctgtatcgccggccgat
gagatcagacgtattgcgccgctcttagacgccctgtccgatcagatgcaccgtgtttca
atcgacagcttccaaccggaaacccagcgctatgcgctcaagcgcggcgtgggctacctg
aacgatatccaaggatttcctgaccctgcgctctatcccgatattgctgaggcggactgc
aggctggtggttatgcactcagcgcagcgggatggcatcgccacccgcaccggtcacctt
cgacccgaagacgcgctcgacgagattgtgcggttcttcgaggcgcgggtttccgccttg
cgacggagcggggtcgctgccgaccggctcatcctcgatccggggatgggatttttcttg
agccccgcaccggaaacatcgctgcacgtgctgtcgaaccttcaaaagctgaagtcggcg
ttggggcttccgctattggtctcggtgtcgcggaaatccttcttgggcgccaccgttggc
cttcctgtaaaggatctgggtccagcgagccttgcggcggaacttcacgcgatcggcaat
ggcgctgactacgtccgcacccacgcgcctggagatctgcgaagcgcaatcaccttctcg
gaaaccctcgcgaaatttcgcagtcgcgacgccagagaccgagggttagatcatgcctag

DBGET integrated database retrieval system