KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01291Help
Entry
ABZJ_01291        CDS       T01820                                 

Definition
dihydropteroate synthetase type 1
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABZJ_01291
Enzymes [BR:abz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ABZJ_01291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346019..1346858
Genome map
AA seq 279 aa AA seqDB search
MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPAD
EIRRIAPLLDALSDQMHRVSIDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADC
RLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSALRRSGVAADRLILDPGMGFFL
SPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAELHAIGN
GADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGLDHA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggtgacggtgttcggcattctgaatctcaccgaggactccttcttcgatgagagccgg
cggctagaccccgccggcgctgtcaccgcggcgatcgaaatgctgcgagtcggatcagac
gtcgtggatgtcggaccggccgccagccatccggacgcgaggcctgtatcgccggccgat
gagatcagacgtattgcgccgctcttagacgccctgtccgatcagatgcaccgtgtttca
atcgacagcttccaaccggaaacccagcgctatgcgctcaagcgcggcgtgggctacctg
aacgatatccaaggatttcctgaccctgcgctctatcccgatattgctgaggcggactgc
aggctggtggttatgcactcagcgcagcgggatggcatcgccacccgcaccggtcacctt
cgacccgaagacgcgctcgacgagattgtgcggttcttcgaggcgcgggtttccgccttg
cgacggagcggggtcgctgccgaccggctcatcctcgatccggggatgggatttttcttg
agccccgcaccggaaacatcgctgcacgtgctgtcgaaccttcaaaagctgaagtcggcg
ttggggcttccgctattggtctcggtgtcgcggaaatccttcttgggcgccaccgttggc
cttcctgtaaaggatctgggtccagcgagccttgcggcggaacttcacgcgatcggcaat
ggcgctgactacgtccgcacccacgcgcctggagatctgcgaagcgcaatcaccttctcg
gaaaccctcgcgaaatttcgcagtcgcgacgccagagaccgagggttagatcatgcctag

DBGET integrated database retrieval system