KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01805Help
Entry
ABZJ_01805        CDS       T01820                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:abz00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1867989..1868846
Genome map
AA seq 285 aa AA seqDB search
MFITTTRPNDALIEQLLPILEEASQILLQEYQNYSAGYEFTIQEKHDDSPVTQADLKVNR
FLLKHLAEITPELPVLSEESDYSARHAWSSCWMLDPLDGTKEFIHERDEFTINLSLIEGR
ETIFSVIVVPCEQVVYLGYLKDLPFKYSFSQQQWYQYQKTPYSKQAPVQIGLSHSSKNPK
YQKFIEPIEKIRTVIRREAGSAYKFCMMLEGEIDIYPRFHPTSEWDTSSGQGLLESIGGG
LLTLTGKPFEYNQRDTVLNGGFIAFRDQESKKIAFEALAQSGVLD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttataacaacaactcgccccaatgatgctttaattgaacagttactaccaatcttg
gaagaagctagccaaatcttattacaagaatatcaaaattattcggctggatatgaattt
acgattcaagaaaaacatgatgattcacctgtaacgcaagcagatttaaaggtaaatcgt
tttttattaaagcatcttgcagaaattacacctgagttaccggttttatcggaagaaagt
gactatagcgctcgccatgcttggtcttcttgctggatgctagatccacttgatggtacg
aaagagtttatacatgagcgagatgagttcacgataaacttgagtttgattgaagggcgt
gaaacgattttttcggtgattgttgtgccatgtgagcaagttgtttatttaggttattta
aaagatttaccttttaaatatagctttagccaacaacaatggtatcaatatcaaaaaaca
ccttattcaaaacaagctcctgtacaaattggtttaagtcatagtagtaaaaatccgaaa
tatcagaaattcattgaacctattgaaaagattcgtaccgtaattcgacgtgaagcaggc
agcgcttataagttttgtatgatgttagaaggagagatcgatatttatcctagatttcat
ccgacatcagaatgggataccagctcaggtcaaggattattagaaagtataggtggaggt
ttactcactctaacaggtaagccctttgaatataaccagcgtgataccgtattaaatggg
ggctttatcgcatttcgtgatcaggaaagcaaaaaaatagcatttgaagctttagctcaa
tcaggtgttttggattga

DBGET integrated database retrieval system