KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01893Help
Entry
ABZJ_01893        CDS       T01820                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00260  Glycine, serine and threonine metabolism
abz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
abz01100  Metabolic pathways
abz01110  Biosynthesis of secondary metabolites
abz01130  Biosynthesis of antibiotics
abz01230  Biosynthesis of amino acids
Module
abz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABZJ_01893
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABZJ_01893
Enzymes [BR:abz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABZJ_01893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEP06353
UniProt: G2JHI0
Position
1954200..1955405
Genome map
AA seq 401 aa AA seqDB search
MQHQINGIALPNEQGFFGEYGGQFIPPHLKEAMDEINVAYEEIRHTPEFQNELADLFANY
VGRPSPLFYAKRLSEQLGGAQIYLKREDLNHTGAHKINHCLGEALLAKYMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVVKMKILGAHLVSVTRGTATLKDAVD
SAFEEYLKDPKNFIYAIGSVVGPHPFPKMVRDFQSIIGKEIKEQTHQRFGKNPDYVVACV
GGGSNAIGAFTAFLNDSDVKLVGVEPAGHGLDTNMHSATLTLGKPSQIHGMACYVLENEA
GEPLPVHSIASGLDYPGVGPQHSFLKDLGRVEYSIATDQECLDAFMTLSRVEGIVPALES
SHAVAWAIREAPKLSKETMIVVNLSGRGDKDSDYVAEKLKL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcaaattaatggtattgctttaccaaatgaacaaggattttttggtgagtat
ggaggtcagtttattcctccgcatttaaaagaagcaatggatgaaattaatgttgcttat
gaagaaattcgccatacaccagaatttcaaaatgaattagcagacctctttgcaaattat
gtcggccgtccaagtcctttattttatgcaaaacgcctttcagaacagttaggtggcgca
caaatttatttaaagcgtgaagacttaaatcatacgggtgcccataaaattaatcactgt
ttaggtgaggctctacttgctaaatatatgggcaaaaagaaagttattgccgaaacgggt
gcgggtcaacatggggttgctttagcaacagcttgtgctctagtgggtattccatgtgaa
atccacatggggcaagttgatattgaaaaagaacatccaaatgtggtcaaaatgaaaatt
ttgggcgctcatttggtgtcagtaactcgcggtacagcaaccttaaaagatgctgtagat
agcgcgtttgaagaatatttaaaagatcctaaaaactttatttatgcgattggttctgtg
gttggtccccatccatttcctaaaatggttcgagattttcaatcaattattggtaaggaa
attaaagagcagacgcatcaacgatttggtaaaaacccagattatgttgtcgcatgtgtc
ggtggcggttcaaatgcaatcggtgcctttacagcttttttaaatgattcagatgtgaaa
cttgtaggagttgaacctgctgggcatgggctagatacaaatatgcattcggcaacccta
acattaggtaaaccaagccaaattcatggtatggcatgttatgttcttgaaaatgaggct
ggtgaacctttacctgtgcattctatcgcttcaggattggactatcctggtgttgggcca
caacatagtttcttaaaagatttaggccgtgtggaatatagcattgcaactgaccaagaa
tgtttagatgcgtttatgaccttatcacgagttgaaggtattgttcctgcgcttgaaagc
tcacatgctgtcgcatgggcaatacgtgaagcgccaaaactgtcgaaagaaaccatgatc
gtggtaaatctgtcgggtcgtggcgataaagattctgattatgtggcagaaaaacttaag
ctttaa

DBGET integrated database retrieval system