KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01941Help
Entry
ABZJ_01941        CDS       T01820                                 

Definition
dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ABZJ_01941
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ABZJ_01941
Enzymes [BR:abz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ABZJ_01941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2007107..2007892
Genome map
AA seq 261 aa AA seqDB search
MTKLLDGKVAFITGSASGIGLEIAKKFAQEGAKVVISDMNAEKCQETANSLKERGFDALS
APCDVTDEDNYKQAIELTQKTFGTVDILINNAGFQHVASIEEFPTAVFQKLVQVMLTGAF
IGIKHVFPIMKAQKYGRIINMASINGLIGFAGKAGYNSAKHGVIGLTKVAALECARDGIT
VNALCPGYVDTPLVRGQIADLAKTRNVSLDSALEDVILAMVPQKRLLSVEEIADYAIFLA
SEKAGGVTGQAVVMDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacttttagacggtaaggtcgcttttattacaggttctgcaagtggtatcggt
ctagagattgctaagaaatttgctcaagaaggtgccaaagttgttatttctgatatgaat
gctgaaaagtgtcaagaaacagcaaactcacttaaagagcgaggttttgatgcattatct
gcaccatgtgatgtgactgatgaagataattataaacaagccattgagcttactcaaaag
acctttggtacggttgatatcttaattaataatgctggtttccaacatgttgcatctatt
gaagaatttccaacggctgtttttcaaaagttagttcaagtcatgttaactggggcattt
attggtattaaacatgtttttccaatcatgaaagctcagaaatatggtcgtattattaat
atggcttcaattaatggcttgattggtttcgctggaaaggcaggttataacagcgctaaa
catggtgtgatcggtctaacaaaagttgccgcattagaatgtgcacgtgatggtattacg
gtaaatgctttatgtccggggtatgtagatacaccattggttcgtgggcaaattgcagat
ttggctaaaacccgtaatgtaagtttagacagtgcacttgaggatgtaattttggcaatg
gttcctcaaaagcgtttgctatctgttgaagaaatcgctgattatgcaattttccttgcg
agtgaaaaagcaggtggggtaacaggccaagctgtcgtgatggatggcggttatacggcc
caataa

DBGET integrated database retrieval system