KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_01941Help
Entry
ABZJ_01941        CDS       T01820                                 

Definition
(GenBank) dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
abz00072  Synthesis and degradation of ketone bodies
abz00650  Butanoate metabolism
abz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    ABZJ_01941
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    ABZJ_01941
Enzymes [BR:abz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     ABZJ_01941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 3HCDH_N Epimerase Sacchrp_dh_NADP Ribosomal_L12 DUF4406
Motif
Other DBs
NCBI-ProteinID: AEP06401
UniProt: G2JJ92
Position
2007107..2007892
Genome map
AA seq 261 aa AA seqDB search
MTKLLDGKVAFITGSASGIGLEIAKKFAQEGAKVVISDMNAEKCQETANSLKERGFDALS
APCDVTDEDNYKQAIELTQKTFGTVDILINNAGFQHVASIEEFPTAVFQKLVQVMLTGAF
IGIKHVFPIMKAQKYGRIINMASINGLIGFAGKAGYNSAKHGVIGLTKVAALECARDGIT
VNALCPGYVDTPLVRGQIADLAKTRNVSLDSALEDVILAMVPQKRLLSVEEIADYAIFLA
SEKAGGVTGQAVVMDGGYTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacttttagacggtaaggtcgcttttattacaggttctgcaagtggtatcggt
ctagagattgctaagaaatttgctcaagaaggtgccaaagttgttatttctgatatgaat
gctgaaaagtgtcaagaaacagcaaactcacttaaagagcgaggttttgatgcattatct
gcaccatgtgatgtgactgatgaagataattataaacaagccattgagcttactcaaaag
acctttggtacggttgatatcttaattaataatgctggtttccaacatgttgcatctatt
gaagaatttccaacggctgtttttcaaaagttagttcaagtcatgttaactggggcattt
attggtattaaacatgtttttccaatcatgaaagctcagaaatatggtcgtattattaat
atggcttcaattaatggcttgattggtttcgctggaaaggcaggttataacagcgctaaa
catggtgtgatcggtctaacaaaagttgccgcattagaatgtgcacgtgatggtattacg
gtaaatgctttatgtccggggtatgtagatacaccattggttcgtgggcaaattgcagat
ttggctaaaacccgtaatgtaagtttagacagtgcacttgaggatgtaattttggcaatg
gttcctcaaaagcgtttgctatctgttgaagaaatcgctgattatgcaattttccttgcg
agtgaaaaagcaggtggggtaacaggccaagctgtcgtgatggatggcggttatacggcc
caataa

DBGET integrated database retrieval system