KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_02212Help
Entry
ABZJ_02212        CDS       T01820                                 

Definition
Outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ABZJ_02212
   00565 Ether lipid metabolism
    ABZJ_02212
   00590 Arachidonic acid metabolism
    ABZJ_02212
   00591 Linoleic acid metabolism
    ABZJ_02212
   00592 alpha-Linolenic acid metabolism
    ABZJ_02212
Enzymes [BR:abz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ABZJ_02212
    3.1.1.32  phospholipase A1
     ABZJ_02212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2292753..2293910)
Genome map
AA seq 385 aa AA seqDB search
MNMAFRQFERTSLQLSMGTLLSCLCASVAYADTLAPVKPASVDACVALASNADRLACYDA
VFKPSALPVVQAAVVPEPVKKIDKPVVQPETFKEKVVDKVSNIKVIGKAPTLEPTTSLLD
QRWELSEKSKLGVWNIRAYQPVYLLPVFWTSDKNEFPSSPNPNNTVTEAQNLKSTESKFQ
ISLKTKAWENIFGNNGDLWVGYTQSSRWQTFNAEESRPFRETNYEPEASLMFRTNYELLG
LDGRLLGVTLNHQSNGRSDPLSRSWNRVIFNVGLERGNFALMLRPWIRLEEDSKDDNNPD
MEDYIGRGDLTAFYKWKQNDFSLMLRHSLKGGDDSHGAVQFDWAFPISGKLRGHFQLFNG
YGESLIDYNHRATYAGLGVSLMNWY
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcgttcagacaatttgaacgcacatctttacagctaagtatgggaaccctg
cttagctgtttatgtgcgtcggtggcatatgccgacaccttagcccctgtaaaacctgcg
agtgtagatgcatgtgttgcccttgcttcgaatgctgatcgcctagcttgttatgatgct
gtgtttaaaccatcggccttaccagtagttcaagccgcagtagtaccagagcctgttaaa
aaaattgataaacctgttgttcaacctgaaacatttaaagaaaaggttgtagataaggta
agtaatatcaaagtaattggtaaggcacctacacttgaacctactacgtctttactagat
caacgttgggagttgtctgaaaaaagtaaactgggtgtttggaatattcgtgcttatcaa
cctgtttacttgctaccagttttctggacgagcgataaaaatgagtttccaagcagtcca
aacccaaataatacggtgacagaggcccaaaaccttaaatcaactgaaagtaaatttcag
atttctttgaaaacgaaagcttgggaaaatatttttggtaacaatggtgacttgtgggta
ggttatacccaatcttcacgttggcagacctttaatgctgaagagtctcgtccattccgt
gaaacgaactatgagccagaagcaagtttaatgtttagaacaaactatgagttgcttggc
ttagatggtcgtttgcttggggtaactttaaatcaccagtcaaatggacgttcagatcct
ttatctcgtagttggaaccgtgtcatctttaatgtgggtttagaacgcggtaactttgct
ttaatgcttcgtccatggatacgccttgaagaagacagcaaagatgataacaatccagat
atggaagattacatcggtcgtggtgatttaactgctttttataagtggaagcaaaatgac
ttctcattaatgctacgtcactctttaaaaggtggtgatgattctcatggtgctgttcag
tttgactgggctttcccgattagtggcaagctgcgcggacacttccaattatttaatggt
tatggtgaaagcttaattgactataaccatcgtgcaacttatgccggcttgggtgtttca
ctcatgaactggtactaa

DBGET integrated database retrieval system