KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_02499Help
Entry
ABZJ_02499        CDS       T01820                                 

Definition
putative acetyl-CoA synthetase/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:abz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABZJ_02499
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABZJ_02499
   00620 Pyruvate metabolism
    ABZJ_02499
   00640 Propanoate metabolism
    ABZJ_02499
  Energy metabolism
   00680 Methane metabolism
    ABZJ_02499
Enzymes [BR:abz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ABZJ_02499
Lipid biosynthesis proteins [BR:abz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ABZJ_02499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2565837..2567495)
Genome map
AA seq 552 aa AA seqDB search
MKVSIMKTLAEAYQQFDLTRLIEEQLVGHPQAINAYVECCERYVGKYKTALIWEGKNGQA
EHYTFEQLAELSGKLANFFKAQGIQAGDCIAGLLPRTPELLITILATWRIGAIYQPLFTA
FEAKSIDHRITTAQTKLIVTNDEQRPKLNTLNVPVIVTVHQTGLLSEHDFDFWQSLQRYS
EQCEPVNRSFDDDFLMMFTSGTTGLAKSVPVPLKAILAFKGYMTHAVDLREEDMFWNLAD
PGWAYGLYYGITGPLSLGHGIIMDERSFNVDQAIELIKKYKVSNLTGSPTAFRMFFGFKE
KFDPSIKQHLRVVSSAGEPLTPEVVNWFKQDLEVNIFDQYGQTELGMVIANHHALEHPLK
VGSAGFAIPGHRFAVLDQNYQELPTGGVGILAMDSEQSPLMWFKGYGGNNRKAFVGKYYL
TGDTVTLNEHGGIDFVGRADNVITTSGYRVGPFDVESTLLECEAVLESAVIGKPDPERTE
IVKAFVVLKPAYQACETLKDKLQQYVRNRLSRHAYPKEIEFVDSLPKTTSGKIQRGLLKQ
QEIAKMQQAYAS
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgagcatcatgaaaactttggcagaagcttatcagcaatttgatcttacaagg
ctcatcgaagagcaacttgttgggcatccccaagcaataaatgcttatgttgagtgctgt
gagcgttatgtaggaaaatataaaacagcgcttatctgggaagggaaaaacggacaggca
gagcactatacgttcgaacaacttgctgaactttctggaaaacttgctaacttctttaaa
gcacaaggaattcaagctggagattgtattgcaggacttctaccaagaacgcctgagtta
ttaattacaattttggcaacgtggcgtataggtgctatttatcagcctttatttactgcc
tttgaagcaaaatcgattgatcaccgaattacgactgctcaaactaaattgattgtgacc
aatgatgaacagcgccctaaactgaataccttgaatgttccggttattgtaactgttcat
caaacaggtcttttatctgagcatgactttgatttttggcaatctttacaacgatattct
gagcaatgtgagccagtaaatcgtagctttgatgatgactttttaatgatgtttacctca
ggcacaactggacttgcgaagtctgtacctgttccactaaaagcaattttagcatttaaa
ggttatatgacccatgccgttgatttgcgtgaagaggatatgttctggaatctggcagat
ccgggctgggcatatggtttgtattatggcattaccgggcctttaagcttgggtcatggc
attattatggatgagcgttcatttaatgtagatcaggcaatagaattaattaaaaaatat
aaagtaagtaatttaacaggatcgcctacagcatttcgcatgttctttggatttaaggaa
aaatttgacccttcaattaaacaacatttacgcgtagtgagcagtgcaggtgagccatta
actcctgaggttgtgaactggtttaagcaggatttagaggtcaatatttttgatcaatat
ggccaaactgagctagggatggtgattgcaaatcatcatgctcttgagcatccattaaaa
gtaggttcagctggttttgcaattcctggacatcgttttgcggtgttagaccaaaattat
caagaattgccaactggtggtgttggtattttggcaatggactcggagcaatctccattg
atgtggtttaaaggttatggtggcaataatcgcaaagcctttgttggcaaatattattta
actggtgacacggtcactttaaacgaacatgggggcattgattttgtgggacgtgctgac
aatgtcattacaacttcgggctatagagttggaccatttgatgttgaaagtactttgtta
gagtgtgaggcggtattagagtcagcagtaattggtaagccagatccggaacgaaccgaa
atagtcaaagcttttgtggtacttaagcctgcttatcaagcgtgtgaaacattaaaagat
aagttacagcaatatgttcgtaaccgtttatctcgtcatgcttatccaaaagagattgag
tttgtggacagtctaccgaaaaccacgagcggaaaaattcaaagaggactgttgaagcag
caagaaattgcaaaaatgcagcaagcctacgcaagctaa

DBGET integrated database retrieval system