KEGG   Acinetobacter baumannii MDR-ZJ06: ABZJ_03013Help
Entry
ABZJ_03013        CDS       T01820                                 

Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
abz  Acinetobacter baumannii MDR-ZJ06
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:abz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3073932..3074531
Genome map
AA seq 199 aa AA seqDB search
MIGCLIGEVFALEAPTVLLNVNGVGYEIDTPLSTFCQLQKGQKVTLWTHLVVREDAQQLY
GFSDAQEKTIFRTLLKVNGVGPKMALGILSTLNVELLVHTIEHDDVNTLVKVPGVGKKTA
ERLMIELRDRFKTLAQGTSSAAALPQIQFVSNSPVAEAEAALQSLGYKPLEAQKAVAAVK
ADYTESADIIRAALKSMMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatgtttaattggcgaagtgtttgccctagaagccccaactgtcttactgaat
gtaaatggtgtgggctatgaaattgatacaccgctttcaacattttgccaattacaaaaa
ggccagaaagttacgctatggacgcatttggtcgttcgtgaagatgctcagcagctttat
ggttttagtgatgctcaagagaaaactattttccgcaccttactaaaagtaaatggtgtg
ggcccgaaaatggcactaggtattctttctacgttaaatgttgaattgctggtacacaca
attgaacatgacgatgtgaatactttggttaaagttccaggtgtaggcaaaaaaacagct
gaacgtttaatgattgaacttcgtgaccgttttaaaactttggcacaaggaacttctagc
gctgcggccctgcctcagattcaatttgtttcgaactcacctgttgcagaagcagaagca
gccttacagtcactaggttataaacctcttgaggcacaaaaagctgttgcggcggttaaa
gccgattacactgaatcagccgatattattcgtgctgcacttaaatcaatgatgaagtaa

DBGET integrated database retrieval system